Report for 3778.m00104

 > 3778.m00104, length: 1140, copies: 1 

MSVNKTVKLTMPVLLALLLLSYGTGSIRCTTIAGNSTDVLSLLDFKATTNDPRGALSSWNTSIHYCWWSGVKCKP

NTRGRVTALKLAGQGLSGQITSFLGNLTDLHTLDLSSNNFSGQIPPLTNLQKLKYLRLGQNSLDGIIPDSLTNCS

NLFYLDLSNNMLEGTIPPKIGFLNNLSVLAFPLNFLTGNIPSTLGNLTNLNIMLLANNKIDGNIPQELGQLSNLG

WLSLSENNLSGGFPQGFFKNLSSLQILSIQTTLLGGTLPFDIGNTLPNLTKLFLADNMFEGHIPASLGNASLLRG

IDLSLNNSTGHIPNSFGRLSGLSTLNLETNKLEARDNQGWEFLEALRGCNNLNVLSLADNLLFGDVPNSIGGLSI

NLTILLLGGNNLTGIVPLSIGNLQGLISLGLDNNGFSGTIEWIGKLKNLQSLCLRNNNFTGPIPYSIGKLTQLTE

LYLRNNAFEGHIPPSLGNPQLLLKLDLSYNKLQGTIPLEISNLRQLIYLQLASNKLNGEIPDALGMCQNLVTIQM

DQNFLRGDMPISFGNLNSLTILNISHNNLSGTIPVALGYLPLLSKLDLSYNNLQGEVPTVGVFRNVTSAYLDGNS

RLCGGVTDLHMLSCPQVSNRIKRDSDITKRDYNLVRLLVPIFGFVSLTVLIYLTCLAKRTSRRTDLLLLSFGKQF

PRVSYKDLAQATGKFSESNLIGRGSYSSVYRAKLAPTKLQVALKVFDLEVRCADKSFLSECEVLRSIRHRNLLPV

LTACSTIDNSGNAFKALIYEYMPNGNLNMWLHKQFASVASKCLSLAQRVNIAVDIANALSYLHHECERSIVHCDL

KPTNILLDDDMNAYLGDFGISNLVIESRVTSLGHSSPNSSIGLKGTIGYIAPEYAQCGHASTYGDVYSFGIVLLE

MLTGKRPTDPMFENELNIVNFVEKNFPEQIPQIIDAQLQEERKRFQATAKQENGFYICLLSVLQVALSCTRLIPR

ERMNTREIAIKLHAIKTSYAEATKREIVGFECDVDELPNRPSAYTDTLDVRNYSSVQQHGCVPVVDGVLLVYYLG

FANLGNVFYSLSNWDNGIAKDLSFDSLSEQLVMLVITRGQIEETLGLGYLNPAARSAPPLQRLRARRGLWSGRVL

RCYLRVRRNVVESRC

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	104	126	0.024
LRR [Pfam ls]	127	150	0.051
LRR [Pfam ls]	151	174	0.02
LRR [Pfam ls]	223	247	0.011
LRR [Pfam ls]	273	296	1.1
LRR [Pfam ls]	351	374	4
LRR [Pfam ls]	376	399	0.026
LRR [Pfam ls]	423	446	0.022
LRR [Pfam ls]	447	470	0.056
LRR [Pfam ls]	471	494	0.18
LRR [Pfam ls]	543	566	0.0033
LRR [Pfam ls]	567	589	4.3
Ser/Thr pkinase [Pfam fs]	690	940	2e-48
Ser/Thr pkinase [Pfam ls]	690	957	1e-43

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	80	103	4.4
LRR [sensitive, ls]	80	103	91
LRR [sensitive, ls]	104	126	0.0012
LRR [sensitive, ls]	104	126	0.024
LRR [sensitive, ls]	127	150	0.0025
LRR [sensitive, ls]	127	150	0.051
LRR [sensitive, ls]	151	174	0.00098
LRR [sensitive, ls]	151	174	0.02
LRR [sensitive, ls]	175	198	3.3
LRR [sensitive, ls]	175	198	69
LRR [sensitive, ls]	199	222	0.79
LRR [sensitive, ls]	199	222	16
LRR [sensitive, ls]	223	247	0.00054
LRR [sensitive, ls]	223	247	0.011
LRR [sensitive, ls]	248	272	1.3
LRR [sensitive, ls]	248	272	26
LRR [sensitive, ls]	273	296	0.054
LRR [sensitive, ls]	273	296	1.1
LRR [sensitive, ls]	321	350	5.4
LRR [sensitive, ls]	321	350	110
LRR [sensitive, ls]	351	374	0.19
LRR [sensitive, ls]	351	374	4
LRR [sensitive, ls]	376	399	0.0013
LRR [sensitive, ls]	376	399	0.026
LRR [sensitive, ls]	400	422	0.55
LRR [sensitive, ls]	400	422	12
LRR [sensitive, ls]	423	446	0.0011
LRR [sensitive, ls]	423	446	0.022
LRR [sensitive, ls]	447	470	0.0027
LRR [sensitive, ls]	447	470	0.056
LRR [sensitive, ls]	471	494	0.0088
LRR [sensitive, ls]	471	494	0.18
LRR [sensitive, ls]	495	518	0.72
LRR [sensitive, ls]	495	518	15
LRR [sensitive, ls]	519	542	0.53
LRR [sensitive, ls]	519	542	11
LRR [sensitive, ls]	543	566	0.00016
LRR [sensitive, ls]	543	566	0.0033
LRR [sensitive, ls]	567	589	0.21
LRR [sensitive, ls]	567	589	4.3

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	9	800	1e-146
Cf-9 [L. pimpinellifolium]	24	241	1e-16
CLV2 [A. thaliana]	38	582	5e-53
FLS2 [A.thaliana]	38	599	5e-84
Cf-9 [L. pimpinellifolium]	58	586	8e-54
Cf-9 [L. pimpinellifolium]	74	605	4e-52
FLS2 [A.thaliana]	80	991	1e-117
CLV2 [A. thaliana]	83	371	6e-17
FLS2 [A.thaliana]	84	608	4e-67
CLV2 [A. thaliana]	91	603	8e-46
CLV2 [A. thaliana]	176	584	2e-44
FLS2 [A.thaliana]	273	614	8e-41
Pto [L. esculentum]	677	941	2e-24
Rpg1 [Hordeum vulgare]	679	905	6e-21
Rpg1 [Hordeum vulgare]	683	930	4e-17

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	13	35	in -> out

Report for 3778.m00104

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)