Report for 3778.m00105

 > 3778.m00105, length: 305, copies: 1 

MDEGARCDTAVELCFLRPLSKDQLPNLVLLVFGKTDLQGEFATAVRSEWRFPSIPISMPYALPQRFHIVHMDIKY

IICLFIHILQISRKASRKDPSGALSSWNTSTHFCWWKGVMCTTARPFRVSTLNLSAQSLAGEITSSLANLTFLRA

LDLSSNRFFGRFPLLNHLQHLGFLYMNDNSLDGIISDTLTNCSKLTQIDLSNNQLQGAIPPRIGSLEYLNLGNNS

LTGIIPATIGNLVKFGYLNLGMNNLTGIIPATVENLTLLTVLRLEYNQFEGKIPDGVWQLANLTYLLLGQNRLSG

GFHRP

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	147	169	8.7
LRR [Pfam ls]	170	193	2.5
LRR [Pfam ls]	194	214	2.4
LRR [Pfam ls]	215	238	0.0015
LRR [Pfam ls]	263	287	4.5

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	123	146	3.3
LRR [sensitive, ls]	123	146	68
LRR [sensitive, ls]	147	169	0.42
LRR [sensitive, ls]	147	169	8.7
LRR [sensitive, ls]	170	193	0.12
LRR [sensitive, ls]	170	193	2.5
LRR [sensitive, ls]	194	214	0.11
LRR [sensitive, ls]	194	214	2.4
LRR [sensitive, ls]	215	238	7.2e-05
LRR [sensitive, ls]	215	238	0.0015
LRR [sensitive, ls]	239	262	0.66
LRR [sensitive, ls]	239	262	14
LRR [sensitive, ls]	263	287	0.22
LRR [sensitive, ls]	263	287	4.5

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	81	304	1e-19
CLV2 [A. thaliana]	89	301	1e-16
Xa21 [O. sativa]	98	300	1e-34
Cf-9 [L. pimpinellifolium]	101	296	7e-12
CLV2 [A. thaliana]	115	300	6e-18
CLV2 [A. thaliana]	116	300	2e-16
Cf-9 [L. pimpinellifolium]	122	281	2e-13
CLV2 [A. thaliana]	122	304	1e-11
Xa21 [O. sativa]	123	301	8e-16
CLV2 [A. thaliana]	124	303	2e-16
CLV2 [A. thaliana]	124	280	4e-14
FLS2 [A.thaliana]	124	304	2e-20
FLS2 [A.thaliana]	124	300	7e-18
FLS2 [A.thaliana]	124	300	3e-15
Xa21 [O. sativa]	124	300	8e-16
Xa21 [O. sativa]	124	304	4e-15
Cf-9 [L. pimpinellifolium]	126	300	5e-15
CLV2 [A. thaliana]	126	300	9e-11
Xa21 [O. sativa]	126	300	1e-15
Cf-9 [L. pimpinellifolium]	127	302	3e-14
CLV2 [A. thaliana]	127	299	1e-16
CLV2 [A. thaliana]	127	300	2e-16
FLS2 [A.thaliana]	127	300	5e-19
FLS2 [A.thaliana]	127	300	8e-14
FLS2 [A.thaliana]	128	300	5e-25
FLS2 [A.thaliana]	128	300	5e-16
FLS2 [A.thaliana]	134	300	5e-22
Cf-9 [L. pimpinellifolium]	146	300	3e-15

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 3778.m00105

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)