Report for 3778.m00110

 > 3778.m00110, length: 274, copies: 2 

MVVPSALLLPLPLLLLCYGFGNIHCSPVHRSSIDLHSLLDFKQGISSDPNEALKSWNTSTHYCKWTGVMCTQTRP

WRVSGLNLTGLSLGGQISSSLGNLTFLNYLDLSYNNFFGPLPLLNRLQQLKNLILGSNSLHGAIPVSLTNSSSLS

YLDLSTNLLVGAIPANISLLSNLEYLDLDQNNLTGTVLQTIGDITSLEILYLFQNQLSGSIPDKIWQLPNLMQLV

LGENNLSGGIPQTLHNISSLQRLGLEYNMLSKALPPNIGDALSNLEVLG

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	148	171	3
LRR [Pfam ls]	172	195	1.6
LRR [Pfam ls]	196	219	0.3
LRR [Pfam ls]	244	268	3.9

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	77	100	2.7
LRR [sensitive, ls]	77	100	57
LRR [sensitive, ls]	101	123	0.57
LRR [sensitive, ls]	101	123	12
LRR [sensitive, ls]	124	147	0.98
LRR [sensitive, ls]	124	147	20
LRR [sensitive, ls]	148	171	0.14
LRR [sensitive, ls]	148	171	3
LRR [sensitive, ls]	172	195	0.077
LRR [sensitive, ls]	172	195	1.6
LRR [sensitive, ls]	196	219	0.014
LRR [sensitive, ls]	196	219	0.3
LRR [sensitive, ls]	220	243	0.69
LRR [sensitive, ls]	220	243	14
LRR [sensitive, ls]	244	268	0.19
LRR [sensitive, ls]	244	268	3.9

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	8	273	6e-37
FLS2 [A.thaliana]	27	187	1e-10
CLV2 [A. thaliana]	34	263	6e-25
FLS2 [A.thaliana]	34	272	2e-37
Cf-9 [L. pimpinellifolium]	37	268	1e-16
Cf-9 [L. pimpinellifolium]	55	264	5e-16
Cf-9 [L. pimpinellifolium]	73	273	2e-16
FLS2 [A.thaliana]	77	273	4e-21
Xa21 [O. sativa]	77	272	2e-17
CLV2 [A. thaliana]	78	273	1e-20
CLV2 [A. thaliana]	78	273	4e-19
CLV2 [A. thaliana]	78	260	6e-17
FLS2 [A.thaliana]	78	265	2e-22
FLS2 [A.thaliana]	78	265	3e-22
FLS2 [A.thaliana]	78	264	6e-22
Cf-9 [L. pimpinellifolium]	81	273	2e-13
Cf-9 [L. pimpinellifolium]	81	260	2e-12
Cf-9 [L. pimpinellifolium]	81	248	2e-11
CLV2 [A. thaliana]	81	260	1e-19
CLV2 [A. thaliana]	81	260	2e-17
FLS2 [A.thaliana]	81	274	3e-21
FLS2 [A.thaliana]	81	272	2e-20
Xa21 [O. sativa]	81	262	3e-22
Xa21 [O. sativa]	81	265	4e-20
FLS2 [A.thaliana]	82	260	1e-19
CLV2 [A. thaliana]	87	273	1e-16
FLS2 [A.thaliana]	87	263	1e-19
Xa21 [O. sativa]	90	273	9e-15
Xa21 [O. sativa]	94	264	3e-19

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 3778.m00110

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)