Report for 3783.m00156

 > 3783.m00156, length: 1040, copies: 2 

MEATVPVLLLVTVLSLILPSGIGAAAAGDERSALLALKAGFVDTVSALADWTDGGKASPHCKWTGVGCNAAGLVD

RLELSGKNLSGKVADDVFRLPALAVLNISNNAFATTLPKSLPSLPSLKVFDVSQNSFEGGFPAGLGGCADLVAVN

ASGNNFAGPLPEDLANATSLETIDMRGSFFGGAIPAAYRSLTKLKFLGLSGNNITGKIPPEIGEMESLESLIIGY

NELEGGIPPELGNLANLQYLDLAVGNLDGPIPPELGKLPALTSLYLYKNNLEGKIPPELGNISTLVFLDLSDNAF

TGAIPDEVAQLSHLRLLNLMCNHLDGVVPAAIGDMPKLEVLELWNNSLTGSLPASLGRSSPLQWVDVSSNGFTGG

IPAGICDGKALIKLIMFNNGFTGGIPAGLASCASLVRVRVHGNRLNGTIPVGFGKLPLLQRLELAGNDLSGEIPG

DLASSASLSFIDVSRNHLQYSIPSSLFTIPTLQSFLASDNMISGELPDQFQDCPALAALDLSNNRLAGAIPSSLA

SCQRLVKLNLRRNKLAGEIPRSLANMPALAILDLSSNVLTGGIPENFGSSPALETLNLAYNNLTGPVPGNGVLRS

INPDELAGNAGLCGGVLPPCSGSRSTAAGPRSRGSARLRHIAVGWLVGMVAVVAAFAALFGGHYAYRRWYVDGAG

CCDDENLGGESGAWPWRLTAFQRLGFTCAEVLACVKEANVVGMGATGVVYKAELPRARAVIAVKKLWRPAAAAEA

AAAAPELTAEVLKEVGLLGRLRHRNIVRLLGYMHNEADAMMLYEFMPNGSLWEALHGPPERRTLVDWVSRYDVAA

GVAQGLAYLHHDCHPPVIHRDIKSNNILLDANMEARIADFGLARALGRAGESVSVVAGSYGYIAPEYGYTMKVDQ

KSDTYSYGVVLMELITGRRAVEAAFGEGQDIVGWVRNKIRSNTVEDHLDGQLVGAGCPHVREEMLLVLRIAVLCT

ARLPRDRPSMRDVITMLGEAKPRRKSGSSTGSASAKAPTPAPPAVAAVVDKDKPVFTTTPDSDYA

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	97	120	4.6
LRR [Pfam ls]	193	216	0.024
LRR [Pfam ls]	217	240	0.086
LRR [Pfam ls]	265	288	0.076
LRR [Pfam ls]	289	312	0.25
LRR [Pfam ls]	313	336	3.3
LRR [Pfam ls]	337	360	0.41
LRR [Pfam ls]	409	432	0.96
LRR [Pfam ls]	433	456	3
LRR [Pfam ls]	505	528	4.9
LRR [Pfam ls]	529	552	0.3
LRR [Pfam ls]	553	576	0.31
LRR [Pfam ls]	577	599	5.5
Ser/Thr pkinase [Pfam fs]	710	917	2.8e-43
Ser/Thr pkinase [Pfam ls]	710	989	1.3e-35

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	97	120	0.22
LRR [sensitive, ls]	97	120	4.6
LRR [sensitive, ls]	121	144	0.55
LRR [sensitive, ls]	121	144	11
LRR [sensitive, ls]	145	168	2.2
LRR [sensitive, ls]	145	168	46
LRR [sensitive, ls]	169	192	1.3
LRR [sensitive, ls]	169	192	27
LRR [sensitive, ls]	193	216	0.0011
LRR [sensitive, ls]	193	216	0.024
LRR [sensitive, ls]	217	240	0.0041
LRR [sensitive, ls]	217	240	0.086
LRR [sensitive, ls]	241	264	0.46
LRR [sensitive, ls]	241	264	9.5
LRR [sensitive, ls]	265	288	0.0037
LRR [sensitive, ls]	265	288	0.076
LRR [sensitive, ls]	289	312	0.012
LRR [sensitive, ls]	289	312	0.25
LRR [sensitive, ls]	313	336	0.16
LRR [sensitive, ls]	313	336	3.3
LRR [sensitive, ls]	337	360	0.02
LRR [sensitive, ls]	337	360	0.41
LRR [sensitive, ls]	361	384	3.5
LRR [sensitive, ls]	361	384	72
LRR [sensitive, ls]	385	408	1.7
LRR [sensitive, ls]	385	408	36
LRR [sensitive, ls]	409	432	0.046
LRR [sensitive, ls]	409	432	0.96
LRR [sensitive, ls]	433	456	0.15
LRR [sensitive, ls]	433	456	3
LRR [sensitive, ls]	457	480	0.47
LRR [sensitive, ls]	457	480	9.9
LRR [sensitive, ls]	481	504	0.44
LRR [sensitive, ls]	481	504	9.1
LRR [sensitive, ls]	505	528	0.24
LRR [sensitive, ls]	505	528	4.9
LRR [sensitive, ls]	529	552	0.014
LRR [sensitive, ls]	529	552	0.3
LRR [sensitive, ls]	553	576	0.015
LRR [sensitive, ls]	553	576	0.31
LRR [sensitive, ls]	577	599	0.26
LRR [sensitive, ls]	577	599	5.5

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	1	618	2e-81
Xa21 [O. sativa]	4	806	3e-86
CLV2 [A. thaliana]	30	613	8e-70
Cf-9 [L. pimpinellifolium]	69	630	8e-54
FLS2 [A.thaliana]	71	1001	1e-122
CLV2 [A. thaliana]	77	556	1e-52
Cf-9 [L. pimpinellifolium]	164	596	2e-34
Cf-9 [L. pimpinellifolium]	214	592	6e-33
Cf-9 [L. pimpinellifolium]	245	602	6e-28
Rpg1 [Hordeum vulgare]	712	992	3e-28
Rpg1 [Hordeum vulgare]	712	989	2e-18
Pto [L. esculentum]	716	992	1e-32

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	5	27	in -> out
putative TM domain	641	663	out -> in

Report for 3783.m00156

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)