Report for 3796.m00236

 > 3796.m00236, length: 484, copies: 1 

MGAVGVEAGVFDTVDGLVGEGASQCFPSTSTRAAPGIAAPVAATTTTSTVAAGLSSSSPVGNAERHASSGTNGFT

ASRVAGTSTSTGRVSMDDSYVRKAKAAMWDGGAAATNSHLPRGPVEANSVAVRADGNYGDDNEKLSLIKLASMIE

VSAKKGARDLNLQGKLMAQIEWLPDSIGKLTGLVTLDISENRLLALPDAIGKLFSLAKLDIHANRISQLPESIGD

LRSLIYLNMRGNQLSSLPSSIGRLLNLEELDVGSNGLSSLPDSIGSLTRLKKLIVETNDLDELPYTIGHCVSLVE

LQAGYNHLKALPEAVGKLEPLEILSVRYNNLRSLPTTMASLTKLKEVDVSFNELESIPENFCFATSLIKLNVGNN

FADLQYLPRSIGNLEMLEELDMSNNQIRVLPDSFGNLKHLRVLRAEENPLQVPPRDIALKGAQAVVQYMSDASKR

TTKSEPMKPKKTWVHFCFFSRPNKRKHDRIDNAT

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	182	204	2.7
LRR [Pfam ls]	205	227	0.63
LRR [Pfam ls]	228	250	0.29
LRR [Pfam ls]	251	273	0.0087
LRR [Pfam ls]	297	319	6
LRR [Pfam ls]	343	365	0.18
LRR [Pfam ls]	391	413	0.0027

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	182	204	0.1
LRR [sensitive, ls]	182	204	2.7
LRR [sensitive, ls]	205	227	0.024
LRR [sensitive, ls]	205	227	0.63
LRR [sensitive, ls]	228	250	0.011
LRR [sensitive, ls]	228	250	0.29
LRR [sensitive, ls]	251	273	0.00033
LRR [sensitive, ls]	251	273	0.0087
LRR [sensitive, ls]	274	296	2.4
LRR [sensitive, ls]	274	296	63
LRR [sensitive, ls]	297	319	0.23
LRR [sensitive, ls]	297	319	6
LRR [sensitive, ls]	320	342	0.62
LRR [sensitive, ls]	320	342	16
LRR [sensitive, ls]	343	365	0.0067
LRR [sensitive, ls]	343	365	0.18
LRR [sensitive, ls]	366	390	0.89
LRR [sensitive, ls]	366	390	24
LRR [sensitive, ls]	391	413	0.0001
LRR [sensitive, ls]	391	413	0.0027
LRR [sensitive, ls]	414	435	0.85
LRR [sensitive, ls]	414	435	22

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	160	456	3e-16
FLS2 [A.thaliana]	173	428	1e-23
FLS2 [A.thaliana]	173	441	1e-15
FLS2 [A.thaliana]	173	426	6e-12
Xa21 [O. sativa]	173	415	3e-17
FLS2 [A.thaliana]	183	425	3e-13

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 3796.m00236

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)