Report for 3806.m00146

 > 3806.m00146, length: 480, copies: 2 

MAGVVTRAVAAAVLVVVVVVAAAELVAAEPPPSERSALLAFLAATPHERRLGWNSSTSACGWVGVTCDAGNATVV

QVRLPGVGLIGAIPPGTLGRLTNLQVLSLRSNRILGGIPDDVLQLPQLRLLFLQNNLLSGAIPPAVSKLAALERL

VLSSNNLSGPIPFTLNNLTSLRALRLDGNKLSGNIPSISIQSLVVFNVSDNNLNGSIPASLARFPAEDFAGNLQL

CGSPLPPCKSFFPSPSPSPGVSPADVPGAASSSKKRRLSGAAIAGIVVGAVVLALLLLVAAVLCAVSKRRRGASE

GPKSTTAAAAGAGAAAARGVPPPGSGEGTGMTSSSKEDMGGASGSAAAAVAAVAAEPSRLVFVGKGAGYSFDLED

LLRASAEVLGKGSVGTSYKAVLEEGTTVVVKRLKDVAVARREFDAHMDALGKVEHRNVLPVRAYYFSKDEKLLVF

DYLPNGSLSAMLHGGGGGACEGVMTARFGL

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	98	121	0.13
LRR [Pfam ls]	122	145	0.2
LRR [Pfam ls]	146	169	0.48
LRR [Pfam ls]	192	215	1.6
Ser/Thr pkinase [Pfam fs]	378	466	2.7e-06

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	98	121	0.0064
LRR [sensitive, ls]	98	121	0.13
LRR [sensitive, ls]	122	145	0.01
LRR [sensitive, ls]	122	145	0.2
LRR [sensitive, ls]	146	169	0.024
LRR [sensitive, ls]	146	169	0.48
LRR [sensitive, ls]	170	191	0.98
LRR [sensitive, ls]	170	191	19
LRR [sensitive, ls]	192	215	0.082
LRR [sensitive, ls]	192	215	1.6

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	32	216	8e-14
Xa21 [O. sativa]	37	208	6e-22
Cf-9 [L. pimpinellifolium]	47	208	2e-11
FLS2 [A.thaliana]	60	208	3e-15
Xa21 [O. sativa]	62	216	1e-18
FLS2 [A.thaliana]	65	212	4e-14
FLS2 [A.thaliana]	68	211	1e-13
Xa21 [O. sativa]	68	211	1e-10
Cf-9 [L. pimpinellifolium]	71	208	1e-13
FLS2 [A.thaliana]	81	207	1e-14
FLS2 [A.thaliana]	83	237	2e-14
FLS2 [A.thaliana]	84	211	6e-17
FLS2 [A.thaliana]	84	211	1e-12
FLS2 [A.thaliana]	84	213	2e-12
FLS2 [A.thaliana]	84	211	5e-12
FLS2 [A.thaliana]	84	208	8e-12
Xa21 [O. sativa]	84	463	1e-18
CLV2 [A. thaliana]	90	214	3e-15
CLV2 [A. thaliana]	90	214	1e-12
FLS2 [A.thaliana]	90	464	5e-21
CLV2 [A. thaliana]	99	212	2e-12

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	5	27	in -> out
putative TM domain	266	288	out -> in

Report for 3806.m00146

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)