Report for 3807.m00116

 > 3807.m00116, length: 523, copies: 1 

MPVASVVLLLHLLSMAAAATAALAMDPAERETLLLVMEAVSSDREWRSVGPDPCGSPWPGLECKPVPAAGNVSSA

AARLHVTRLDFGVAPNPTCKDGAAFPHLAFALPHLQSLFLVDCFKNPAATTAFTLPPSANLTSSRLQQLSVRSNP

SLSGTLPPQLSSIRSLQVLTVSQNALIRGEVPQGIGELKSLVHLDLSYNSLTGTIPSRIGELRSLVGLDLSYNSF

SGSIPGQLGDLAMLQKLDLSSNNLTGGVPATITGLTSLTFLALSNNGLSGHLPAGLSDLLDLQYLIMENNPMGVP

LPSELGDIARLQELRLANSGYSGSIPETLGRLASLTTLSLENNNLTGRIPAGLSRLKRMYHLNLSKNGLDGVVPF

DGAFLRRLGRNLDLSGNPGLCVDGRAVLQADVGVGVCRRAGDGGDIASVSAATDVLSVGTLFRRDGQLWLAGGRC

LMVTGCDLCVADLAINPAAPAICKQFSGTLQPELCPAFHCLPLYNPMSVMPLIALSKGTRCSGQVIMYSSVDV

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	190	213	0.004
LRR [Pfam ls]	214	237	0.37
LRR [Pfam ls]	238	261	0.061
LRR [Pfam ls]	262	285	0.41
LRR [Pfam ls]	334	357	0.0052

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	140	164	0.3
LRR [sensitive, ls]	140	164	8
LRR [sensitive, ls]	165	189	0.29
LRR [sensitive, ls]	165	189	7.8
LRR [sensitive, ls]	190	213	0.00015
LRR [sensitive, ls]	190	213	0.004
LRR [sensitive, ls]	214	237	0.014
LRR [sensitive, ls]	214	237	0.37
LRR [sensitive, ls]	238	261	0.0022
LRR [sensitive, ls]	238	261	0.061
LRR [sensitive, ls]	262	285	0.015
LRR [sensitive, ls]	262	285	0.41
LRR [sensitive, ls]	286	315	1.7
LRR [sensitive, ls]	286	315	46
LRR [sensitive, ls]	334	357	0.00019
LRR [sensitive, ls]	334	357	0.0052
LRR [sensitive, ls]	358	379	0.75
LRR [sensitive, ls]	358	379	20

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	14	392	6e-23
Cf-9 [L. pimpinellifolium]	101	374	7e-18
Cf-9 [L. pimpinellifolium]	102	395	1e-20
FLS2 [A.thaliana]	110	278	8e-23
Xa21 [O. sativa]	129	278	1e-15
FLS2 [A.thaliana]	130	392	3e-33
Xa21 [O. sativa]	130	396	5e-39
FLS2 [A.thaliana]	131	383	2e-39
Xa21 [O. sativa]	131	340	2e-29
Cf-9 [L. pimpinellifolium]	132	392	2e-18
CLV2 [A. thaliana]	132	376	2e-30
FLS2 [A.thaliana]	132	392	3e-33
Xa21 [O. sativa]	132	392	2e-28
FLS2 [A.thaliana]	134	396	1e-31
Xa21 [O. sativa]	135	327	3e-19
FLS2 [A.thaliana]	137	376	6e-30
Xa21 [O. sativa]	139	385	6e-29
Xa21 [O. sativa]	140	383	5e-29
FLS2 [A.thaliana]	143	374	3e-31
CLV2 [A. thaliana]	144	392	6e-28
CLV2 [A. thaliana]	148	392	8e-25
CLV2 [A. thaliana]	148	398	3e-20
FLS2 [A.thaliana]	151	392	2e-31
Cf-9 [L. pimpinellifolium]	160	373	1e-15
FLS2 [A.thaliana]	177	374	4e-27
Xa21 [O. sativa]	177	385	5e-26
Cf-9 [L. pimpinellifolium]	191	374	8e-11
FLS2 [A.thaliana]	191	374	9e-24

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 3807.m00116

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)