Report for 3848.m00195

 > 3848.m00195, length: 958, copies: 2 

MERVLKSARESGSLNLSNRSLREVPKEVYNNLDTGAQDEKWWEGVDLQKLILAHNNLEVLREDLRNLSSLVVLNI

SHNNISSLPAAIGDLPLLKSLDVSSNQINAFPEEIGFATALVKVDCSNNCLTDLPVSLARCLELSELNASNNTIS

VLPDELAGCSKLFRLNLEGNKLVTLSDKMFMSWTMLTEMNAEITLIPPSIKDCSSLAEFYMGNNLLTSIPEDIGM

LSNLGILDLHSNQLKEYPVGACRLKLSFLDLSNNSLSGLPAELDHRADSFFPWGICFENLACSMQVCYYLNELSK

LWTLTYASACYIQGTMTTLRKLLLTGNPMRTLRSSLVSGPTTALLKYLRSRLSSDEGASGSGSTPTKDDQIAAAR

RLSLSSKELDLSGLGVTSVPPAAWETNDVMKLDLSKNSIEDLPNELSLCSSLQSLILSNNKIKRWPGTVFSSLAS

LSLLKLDNNPLAEILATDLEALSKLEVLDLSGSASSLPEPSAVSKLPHLKELYLRRMKLHGFPDSLLGLKLLRIL

DLSQNYLTSVPEGIKDLTSLIELDLSDNNITTLPPELGLLEPNLQVLKLDGNPLRRVIDVKCWYLNANGLTPSLV

PGKDRLNDLPDDVVLNILERLDTSDAMKTCILSKNMRATLPDMLSRIAVDVAAFSRPNHRRLTLREVVRTNGAVA

DLTAAVLEFRRPEIPVHHLALRFYLRSAADDLVYFAGQFHTLFTAYPAVFAGLTRLWFGDSDIAGILLTCKNLRF

LRLFNCKSVRRSVLQIWVEPEGWKRLAPVLGELRHVTLVDLPEGCDIAWTMFIVEAAPRLESLSIRVWDHCCKME

RDETTRQENGYCDKSNVEWQPSVANLEHRNLAKLTIVGFQPDEHFVGFIRRVMESAVNLEEISLYDRVVGRCCSY

LDPKTKSKVVPSRYPRTMKEQVLLRKEDDQGVIIGDGFVSCNSLQVLVVNYYKLEFGI

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	46	68	0.26
LRR [Pfam fs]	69	91	4.4e-05
LRR [Pfam ls]	69	91	0.00075
LRR [Pfam ls]	138	160	0.52
LRR [Pfam ls]	161	184	0.55
LRR [Pfam ls]	205	227	4
LRR [Pfam ls]	250	272	0.12
LRR [Pfam ls]	318	341	4.5
LRR [Pfam ls]	426	449	2.6
LRR [Pfam ls]	450	473	8.4
LRR [Pfam ls]	498	520	4.9
LRR [Pfam ls]	521	543	0.02
LRR [Pfam fs]	544	566	4.8e-05
LRR [Pfam ls]	544	566	0.00082

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	46	68	0.013
LRR [sensitive, ls]	46	68	0.26
LRR [sensitive, ls]	69	91	3.6e-05
LRR [sensitive, ls]	69	91	0.00075
LRR [sensitive, ls]	92	114	0.52
LRR [sensitive, ls]	92	114	11
LRR [sensitive, ls]	115	137	1
LRR [sensitive, ls]	115	137	21
LRR [sensitive, ls]	138	160	0.025
LRR [sensitive, ls]	138	160	0.52
LRR [sensitive, ls]	161	184	0.026
LRR [sensitive, ls]	161	184	0.55
LRR [sensitive, ls]	205	227	0.19
LRR [sensitive, ls]	205	227	4
LRR [sensitive, ls]	228	248	1.4
LRR [sensitive, ls]	228	248	29
LRR [sensitive, ls]	250	272	0.0057
LRR [sensitive, ls]	250	272	0.12
LRR [sensitive, ls]	318	341	0.22
LRR [sensitive, ls]	318	341	4.5
LRR [sensitive, ls]	403	425	0.45
LRR [sensitive, ls]	403	425	9.4
LRR [sensitive, ls]	426	449	0.13
LRR [sensitive, ls]	426	449	2.6
LRR [sensitive, ls]	450	473	0.4
LRR [sensitive, ls]	450	473	8.4
LRR [sensitive, ls]	474	497	1.5
LRR [sensitive, ls]	474	497	31
LRR [sensitive, ls]	498	520	0.23
LRR [sensitive, ls]	498	520	4.9
LRR [sensitive, ls]	521	543	0.00097
LRR [sensitive, ls]	521	543	0.02
LRR [sensitive, ls]	544	566	3.9e-05
LRR [sensitive, ls]	544	566	0.00082
LRR [sensitive, ls]	568	589	0.77
LRR [sensitive, ls]	568	589	16
LRR [sensitive, ls]	727	749	4.8
LRR [sensitive, ls]	727	749	99

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	14	593	1e-25
FLS2 [A.thaliana]	16	260	5e-11
FLS2 [A.thaliana]	47	571	1e-20
Xa21 [O. sativa]	47	577	1e-18
CLV2 [A. thaliana]	60	577	9e-13
Xa21 [O. sativa]	65	556	6e-14
FLS2 [A.thaliana]	195	647	2e-12

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value
F-box domain	604	651	5e-07

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 3848.m00195

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)