Report for 3852.m00141

 > 3852.m00141, length: 1160, copies: 2 

MAALLECFLLAVAVVLVAHAAAPAPAASSRLPLPPPPAAAAGDVSGSDSDRRALMAFKKLVSGDPSQALESWGDG

STPLCRWRGVSCGVAAGRRRGRVVALDLAGAGIAGEVSPALGNLTHLRRLHLPENRLHGALPWQLGRLGELRHLN

LSHNSIAGRIPPPLISGCRRLKNVLLHGNRLHGELPGELLSSLRRLEVLDLGKNTLTGSIPPDIGNLVSLKQLVL

EFNNLTGQIPSQIGKLGNLTMLSLSSNQLSGSIPESIGNLSALTAIAAFSNNLTGRIPPLERLSSLSYLGLASNN

LGGTIPSWLGNLSSLTALDLQSNGFVGCIPESLGDLQFLEAISLADNKLRCRIPDSFGNLHELVELYLDNNELEG

SLPISLFNLSSLEMLNIQDNNLTGVFPPDMGYKLPNLQQFLVSRNQFHGLIPPSLCNLSMIQVIQTVDNFLSGTI

PQCLGRNQNMLSVVNFDGNQLEATNDADWGFMTSLTNCSNMILIDVSINKLQGVLPKAIGNMSTQLEYFGITNNN

ITGTIPESIGNLVNLDELDMENNLLMGSLPASLGNLKKLNRLSLSNNNFSGSIPVTLGNLTKLTILLLSTNALSG

AIPSTLSNCPLEMVDLSYNNLSGPIPKELFLISTISSFLYLAHNKLTGNLPSEVGNLKNLDELDLSDNTISGKIP

TTIGECQSLQYLNLSRNFIEDTIPPSLEQLRGLLVLDLSQNNLSGTIPRFLGSMTGLSTLNLSSNDFEGEVPKYG

IFLNATATSVMGNNDLCGGAPQLKLPKCSNQTKHGLSSKIIIIIIAGSTILFLILFTCFALRLRTKLRRANPKIP

LSDKQHMRVSYAQLSKATNSFASENLIGVGSFGAVYQGRIGISDQQLVVAVKVLNLQQAGAYRSFDAECEALRCI

RHRNLVKILTVCSGIDFQGSDFKALVFEFLPNGNLDQWLHKHLEEEGEPKVLNLVERLQIAIDVASALEYLHQHK

PCPIVHCDLKPSNILLDNDMVAHVGDFGLARFLHQEHSNSSDKSTGWNAIRGTIGYVAPEYGLGNEVSIHGDVYS

YGILLLEMFTGKRPTNSEFGDVLTLHEYVETALPDQTTSVIDQSLLDATWNSEGTAQKYHDIEEIRTECIVSILK

VGILCSKEIPTDRMQIGDALRELQAIRDRFDTHQL

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	145	169	0.004
LRR [Pfam ls]	170	194	1
LRR [Pfam ls]	195	218	0.0076
LRR [Pfam ls]	219	242	1.5
LRR [Pfam ls]	243	266	0.0089
LRR [Pfam ls]	290	313	0.51
LRR [Pfam ls]	314	337	1.4
LRR [Pfam ls]	338	361	2.1
LRR [Pfam ls]	362	385	0.25
LRR [Pfam ls]	386	410	0.066
LRR [Pfam ls]	411	434	6.4
LRR [Pfam ls]	515	538	0.48
LRR [Pfam ls]	539	562	0.13
LRR [Pfam ls]	563	586	0.018
LRR [Pfam ls]	659	682	0.23
LRR [Pfam ls]	683	706	0.002
LRR [Pfam ls]	707	730	0.085
Ser/Thr pkinase [Pfam fs]	846	1065	2.3e-45
Ser/Thr pkinase [Pfam ls]	846	1120	2.2e-37

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	97	120	1.4
LRR [sensitive, ls]	97	120	29
LRR [sensitive, ls]	121	144	0.6
LRR [sensitive, ls]	121	144	12
LRR [sensitive, ls]	145	169	0.00019
LRR [sensitive, ls]	145	169	0.004
LRR [sensitive, ls]	170	194	0.048
LRR [sensitive, ls]	170	194	1
LRR [sensitive, ls]	195	218	0.00036
LRR [sensitive, ls]	195	218	0.0076
LRR [sensitive, ls]	219	242	0.072
LRR [sensitive, ls]	219	242	1.5
LRR [sensitive, ls]	243	266	0.00043
LRR [sensitive, ls]	243	266	0.0089
LRR [sensitive, ls]	267	289	2.8
LRR [sensitive, ls]	267	289	57
LRR [sensitive, ls]	290	313	0.024
LRR [sensitive, ls]	290	313	0.51
LRR [sensitive, ls]	314	337	0.066
LRR [sensitive, ls]	314	337	1.4
LRR [sensitive, ls]	338	361	0.1
LRR [sensitive, ls]	338	361	2.1
LRR [sensitive, ls]	362	385	0.012
LRR [sensitive, ls]	362	385	0.25
LRR [sensitive, ls]	386	410	0.0032
LRR [sensitive, ls]	386	410	0.066
LRR [sensitive, ls]	411	434	0.31
LRR [sensitive, ls]	411	434	6.4
LRR [sensitive, ls]	490	513	0.6
LRR [sensitive, ls]	490	513	13
LRR [sensitive, ls]	515	538	0.023
LRR [sensitive, ls]	515	538	0.48
LRR [sensitive, ls]	539	562	0.0065
LRR [sensitive, ls]	539	562	0.13
LRR [sensitive, ls]	563	586	0.00086
LRR [sensitive, ls]	563	586	0.018
LRR [sensitive, ls]	587	607	0.75
LRR [sensitive, ls]	587	607	16
LRR [sensitive, ls]	610	634	1
LRR [sensitive, ls]	610	634	21
LRR [sensitive, ls]	635	658	4
LRR [sensitive, ls]	635	658	83
LRR [sensitive, ls]	659	682	0.011
LRR [sensitive, ls]	659	682	0.23
LRR [sensitive, ls]	683	706	9.4e-05
LRR [sensitive, ls]	683	706	0.002
LRR [sensitive, ls]	707	730	0.0041
LRR [sensitive, ls]	707	730	0.085
LRR [sensitive, ls]	731	755	1.8
LRR [sensitive, ls]	731	755	38

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	25	774	1e-64
FLS2 [A.thaliana]	53	1154	1e-165
Cf-9 [L. pimpinellifolium]	71	791	4e-71
CLV2 [A. thaliana]	97	386	6e-18
Xa21 [O. sativa]	115	452	2e-44
Xa21 [O. sativa]	247	958	1e-165
CLV2 [A. thaliana]	426	805	4e-37
Pto [L. esculentum]	833	1149	1e-24
Rpg1 [Hordeum vulgare]	839	1151	6e-27
Rpg1 [Hordeum vulgare]	839	1062	2e-18

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	791	813	out -> in

Report for 3852.m00141

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)