Report for 3886.m00147

 > 3886.m00147, length: 1040, copies: 1 

MASTEYAQAFSNETDLDALLAFRAGLSNQSDALASWNATTDFCRWHGVICSIKHKRRVLALNLSSAGLVGYIAPS

IGNLTYLRTLDLSYNLLHGEIPPTIGRLSRMKYLDLSNNSLQGEMPSTIGQLPWLSTLYMSNNSLQGGITHGLRN

CTRLVSIKLDLNKLNREIPDWLDGLSRIKIMSLGKNNFTGIIPPSLGNLSSLREMYLNDNQLSGPIPESLGRLSK

LEMLALQVNHLSGNIPRTIFNLSSLVQIGVEMNELDGTLPSDLGNALPKIQYLILALNHLTGSIPASIANATTMY

SIDLSGNNFTGIVPPEIGTLCPNFLLLNGNQLMASRVQDWEFITLLTNCTSLRGVTLQNNRLGGALPNSIGNLSE

RLQLLDLRFNEISNRIPDGIGNFPKLIKLGLSSNRFTGLIPDNIGRLTMLQFLTLDNNLLSGMMASSLGNLTQLQ

HLSVNNNNLDGPLPASLGNLQRLVSATFSNNKLSGPLPGEIFSLSSLSFVLDLSRNQFSSSLPSEVGGLTKLTYL

YMHNNKLAGALPDAISSCQSLMELRMDGNSLNSTIPVSISKMRGLELLNLTKNSLTGAIPEELGLMKGLKELYLA

HNNLSLQIPETFISMTSLYQLDISFNHLDGQVPTHGVFSNLTGFQFVGNDKLCGGIQELHLPSCRVKSNRRILQI

IRKAGILSASVILVCFILVLLVFYLKKRLRPLSSKVEIVASSFMNQMYPRVSYSDLAKATNGFTSNNLVGTGRYG

SVYKGTMRFKNSVSDVAVKVFDLEQSGSSKSFVAECKALSKIQHRNLVGVITCCSCPNLNQNDFKALVFEFMPYG

SLDRWIHPDIDPSSPVEVLTLMQRLNIALDIGAALDYLHNNCQPAIVHCDLKPSNILLGDGMVAHVGDFGLAKIL

TDPEGEQLINSKSSVGIMGTIGYVAPGIANVAYALQNMEKVVKFLHTVMSTALVYCSLRCLQKYAEMAYPELLID

IVDPLMLSVENASGEINSVITAVTRLALVCSRRRPTDRLCMREVVAEIQTIRASYVEEINKIVSD

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	81	104	0.057
LRR [Pfam ls]	105	128	0.032
LRR [Pfam ls]	177	200	2.2
LRR [Pfam ls]	201	224	0.03
LRR [Pfam ls]	351	374	3.6
LRR [Pfam ls]	376	399	0.047
LRR [Pfam ls]	400	423	0.19
LRR [Pfam ls]	424	447	0.73
LRR [Pfam ls]	448	471	0.25
LRR [Pfam ls]	521	544	0.37
LRR [Pfam ls]	569	592	0.22
LRR [Pfam ls]	593	616	0.15
Ser/Thr pkinase [Pfam fs]	738	926	3.3e-36
Ser/Thr pkinase [Pfam ls]	738	1025	1.3e-21

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	57	80	1
LRR [sensitive, ls]	57	80	24
LRR [sensitive, ls]	81	104	0.0025
LRR [sensitive, ls]	81	104	0.057
LRR [sensitive, ls]	105	128	0.0014
LRR [sensitive, ls]	105	128	0.032
LRR [sensitive, ls]	129	152	1.4
LRR [sensitive, ls]	129	152	32
LRR [sensitive, ls]	153	176	1.1
LRR [sensitive, ls]	153	176	26
LRR [sensitive, ls]	177	200	0.095
LRR [sensitive, ls]	177	200	2.2
LRR [sensitive, ls]	201	224	0.0013
LRR [sensitive, ls]	201	224	0.03
LRR [sensitive, ls]	225	248	0.72
LRR [sensitive, ls]	225	248	17
LRR [sensitive, ls]	274	297	0.25
LRR [sensitive, ls]	274	297	5.7
LRR [sensitive, ls]	298	321	0.27
LRR [sensitive, ls]	298	321	6.2
LRR [sensitive, ls]	351	374	0.16
LRR [sensitive, ls]	351	374	3.6
LRR [sensitive, ls]	376	399	0.002
LRR [sensitive, ls]	376	399	0.047
LRR [sensitive, ls]	400	423	0.0081
LRR [sensitive, ls]	400	423	0.19
LRR [sensitive, ls]	424	447	0.031
LRR [sensitive, ls]	424	447	0.73
LRR [sensitive, ls]	448	471	0.011
LRR [sensitive, ls]	448	471	0.25
LRR [sensitive, ls]	472	496	1.9
LRR [sensitive, ls]	472	496	44
LRR [sensitive, ls]	497	520	1.1
LRR [sensitive, ls]	497	520	25
LRR [sensitive, ls]	521	544	0.016
LRR [sensitive, ls]	521	544	0.37
LRR [sensitive, ls]	545	568	0.39
LRR [sensitive, ls]	545	568	9.2
LRR [sensitive, ls]	569	592	0.0096
LRR [sensitive, ls]	569	592	0.22
LRR [sensitive, ls]	593	616	0.0064
LRR [sensitive, ls]	593	616	0.15
LRR [sensitive, ls]	617	642	0.28
LRR [sensitive, ls]	617	642	6.4

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	11	633	2e-88
CLV2 [A. thaliana]	15	653	9e-56
Xa21 [O. sativa]	18	851	1e-160
Cf-9 [L. pimpinellifolium]	35	624	5e-53
Cf-9 [L. pimpinellifolium]	52	663	3e-55
FLS2 [A.thaliana]	55	195	1e-16
FLS2 [A.thaliana]	68	1036	1e-132
FLS2 [A.thaliana]	154	659	5e-76
Pto [L. esculentum]	708	926	5e-18
Rpg1 [Hordeum vulgare]	710	930	3e-17

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	681	700	out -> in

Report for 3886.m00147

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)