Report for 3917.m00144

 > 3917.m00144, length: 662, copies: 2 

MRSVMMCCLLLLLVSAAAGAEGKSEVALLLERVKPALQGEGEVGGNAQLATWTASTPLCQWRGLRWSTAATLPRE

LPCGNLSAGLAHHPVPDDLLLLLSIRLPASALAGHLPPELAAFSALASIFLAHNSLSGPIPLALGNAPALSLLDL

ASNRLSGSLPLSIWNLCSGNARLSLLRLHGNALHGPIPDPAALAPNTTCDALSLLDLSANRLSGPFPSSLVTTAF

PALRSLDLSDNRLHGPIPHGLAPIHSLNLSYNNFSGQLPPDLASLPPDAFLANSPALCGPPLPHHCLPSNPLTSS

AVAAIVIALMAAAVVLASLSIGWAQGRWRRAPLPPEEGTLTEDGEGKLVVFQGGEHLTLEEVLNATGQVVNKASY

CTVYKAKLAEGGGSIELRLLREGCCKDAESCAPAVRRIGRARHDNLVPLRAFYQGRRGEKLLVYDYFPGNRTLHE

LLHGHGEQSQGMRPALTWARRHKIALGVARALAYVHAGHGEAHGSVRSSNVLVDEWFVARVAEYAVHRLLVAAAV

GKADGYRAPELQSRGRCSPRTDVYAFGILLLELLMGRKASGELPAVVKAAVLEEVTMMEVFDAEVARGVRSPAEE

GLLQALKLAMGCCAPVASARPTMAEVVRQLEEVRPRNSSRPSAIYSPAEPRSDAGTPTAAAV

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	227	247	1
LRR [Pfam ls]	248	271	0.24
Ser/Thr pkinase [Pfam ls]	364	630	1.6e-08
Ser/Thr pkinase [Pfam fs]	417	486	0.07
Ser/Thr pkinase [Pfam fs]	530	559	0.0038

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	120	143	0.3
LRR [sensitive, ls]	120	143	8
LRR [sensitive, ls]	144	168	0.27
LRR [sensitive, ls]	144	168	7.1
LRR [sensitive, ls]	172	194	0.33
LRR [sensitive, ls]	172	194	8.7
LRR [sensitive, ls]	201	221	1.3
LRR [sensitive, ls]	201	221	35
LRR [sensitive, ls]	227	247	0.038
LRR [sensitive, ls]	227	247	1
LRR [sensitive, ls]	248	271	0.0089
LRR [sensitive, ls]	248	271	0.24

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	11	270	2e-21
FLS2 [A.thaliana]	49	269	4e-11
Xa21 [O. sativa]	59	453	8e-18
FLS2 [A.thaliana]	67	267	2e-14
CLV2 [A. thaliana]	93	266	1e-10
FLS2 [A.thaliana]	93	264	1e-14
FLS2 [A.thaliana]	93	270	5e-13
FLS2 [A.thaliana]	94	639	2e-32
Cf-9 [L. pimpinellifolium]	97	264	9e-15
Cf-9 [L. pimpinellifolium]	97	263	2e-11
CLV2 [A. thaliana]	97	264	7e-16
CLV2 [A. thaliana]	97	271	1e-10
FLS2 [A.thaliana]	97	288	1e-13
FLS2 [A.thaliana]	97	270	6e-12
FLS2 [A.thaliana]	97	270	5e-11
FLS2 [A.thaliana]	107	270	2e-14
Pto [L. esculentum]	359	631	3e-20
Rpg1 [Hordeum vulgare]	359	633	8e-14

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	301	323	out -> in

Report for 3917.m00144

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)