Report for 3980.m00118

 > 3980.m00118, length: 393, copies: 2 

MAVLARLGVIVVLWAVVAEGILDPVDFLALQAVRRSLDDMPGSSFFEAWDFTADPCGFPGVFCDGNKVSALALGD

PRAGSPGLSGRLDQALGRLSALTELSLVPGRVEGELPESLSSCRNLRFLAVSKNLISGQIPDGLGGLSNLRTLDV

SFNQISGTIPASIATLPSITNLILCHNHLTGGIPSFPDSSPLIRLDLKHNDLSGGVPNLPSTLQYLSLSANRLTG

TVDSVLPRLTRLNYLDLSMNQLDGPIPASVFTLPLSVLQLQRNFFSGLLQPANDVTIQVVDLSYNRFWGPVSPLL

AGVGQLYLNNNRFTGEVPARLVQELVGSGGLQVLYLQHNFLTGIEISPASSLPSSVSLCLMYNCMVPPVYAPCPL

KAGSTNTRPADQCPEWRG

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	120	143	0.68
LRR [Pfam ls]	144	167	0.0042
LRR [Pfam ls]	168	190	1.3
LRR [Pfam ls]	212	235	0.38
LRR [Pfam ls]	330	353	0.22

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	120	143	0.025
LRR [sensitive, ls]	120	143	0.68
LRR [sensitive, ls]	144	167	0.00015
LRR [sensitive, ls]	144	167	0.0042
LRR [sensitive, ls]	168	190	0.048
LRR [sensitive, ls]	168	190	1.3
LRR [sensitive, ls]	191	210	3.4
LRR [sensitive, ls]	191	210	92
LRR [sensitive, ls]	212	235	0.014
LRR [sensitive, ls]	212	235	0.38
LRR [sensitive, ls]	236	259	0.5
LRR [sensitive, ls]	236	259	14
LRR [sensitive, ls]	281	300	2.3
LRR [sensitive, ls]	281	300	62
LRR [sensitive, ls]	302	326	0.4
LRR [sensitive, ls]	302	326	11
LRR [sensitive, ls]	330	353	0.008
LRR [sensitive, ls]	330	353	0.22

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	26	357	3e-27
FLS2 [A.thaliana]	56	343	3e-23
Xa21 [O. sativa]	56	318	3e-25
FLS2 [A.thaliana]	79	343	4e-24
CLV2 [A. thaliana]	80	274	1e-10
FLS2 [A.thaliana]	80	318	6e-20
CLV2 [A. thaliana]	82	388	4e-22
Cf-9 [L. pimpinellifolium]	83	363	1e-19
Cf-9 [L. pimpinellifolium]	83	343	3e-11
FLS2 [A.thaliana]	83	363	1e-29
FLS2 [A.thaliana]	83	343	6e-28
FLS2 [A.thaliana]	83	369	2e-24
Xa21 [O. sativa]	83	343	5e-17
CLV2 [A. thaliana]	84	343	1e-16
CLV2 [A. thaliana]	92	371	3e-20
Cf-9 [L. pimpinellifolium]	97	322	1e-21
Cf-9 [L. pimpinellifolium]	100	207	1e-10

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 3980.m00118

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)