Report for 4159.m00068

 > 4159.m00068, length: 743, copies: 1 

MASMKGWSSQRRMRFSAAAWPSLPFLESARQSTTFMAYSHEDDEPTHSPSDDVPGADVVDEESNIMHDLGHNDLL

LNLKFNFNEERFKLPEKCFKMFTALKLLLLPYLLLLASASCTQGLPFSNNTDLDALLGFKAGLSHQSDALASWNT

TTSYCQWSGVICSHRHKQRVLALNLTSTGLHGYISASIGNLTYLRSLDLSCNQLYGEIPLTIGWLSKLSYLDLSN

NSFQGEIPRTIGQLPQLSYLYLSNNSLQGEITDELRNCTNLASIKLDLNSLNGKIPDWFGGFLKLNSISVGKNIF

TGIIPQSLGNLSALSELFLNENHLTGPIPEALGKISSLERLALQVNHLSGTIPRTLLNLSSLIHIGLQENELHGR

LPSDLGNGLPKIQYFIVALNHFTGSIPPSIANATNMRSIDLSSNNFTGIIPPEIGMLCLKYLMLQRNQLKATSVK

DWRFITFLTNCTRLRAVTIQNNRLGGALPNSITNLSAQLELLDIGFNKISGKIPDGINNFLKLIKLGLSNNRFSG

PIPDSIGRLETLQYLTLENNLLSGIIPSSLGNLTQLQQLSLDNNSLEGPLPASIGNLQQLIIATFSNNKLRDQLP

GDIFNLPSLSYILDLSRNHFSGSLPSAVGGLTKLTYLYMYSNNFSGLLPNSLSNCQSLMELHLDDNFFNGTIPVS

VSKMRGLVLLNLTKNSLLGAIPQDLRLMDGLKELYLSHNNLSAQIPENMENMTSLYWLDISFNNLDGQ

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	193	216	5
LRR [Pfam ls]	217	240	0.0084
LRR [Pfam ls]	241	264	0.029
LRR [Pfam ls]	289	312	2.5
LRR [Pfam ls]	313	336	1.2
LRR [Pfam ls]	361	385	3.6
LRR [Pfam ls]	410	433	2.9
LRR [Pfam ls]	488	511	0.36
LRR [Pfam ls]	512	535	0.23
LRR [Pfam ls]	536	559	0.0013
LRR [Pfam ls]	560	583	0.14
LRR [Pfam ls]	633	656	0.015
LRR [Pfam ls]	705	728	0.012

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	169	192	2.6
LRR [sensitive, ls]	169	192	60
LRR [sensitive, ls]	193	216	0.21
LRR [sensitive, ls]	193	216	5
LRR [sensitive, ls]	217	240	0.00036
LRR [sensitive, ls]	217	240	0.0084
LRR [sensitive, ls]	241	264	0.0013
LRR [sensitive, ls]	241	264	0.029
LRR [sensitive, ls]	265	288	0.97
LRR [sensitive, ls]	265	288	23
LRR [sensitive, ls]	289	312	0.11
LRR [sensitive, ls]	289	312	2.5
LRR [sensitive, ls]	313	336	0.053
LRR [sensitive, ls]	313	336	1.2
LRR [sensitive, ls]	337	360	0.28
LRR [sensitive, ls]	337	360	6.5
LRR [sensitive, ls]	361	385	0.15
LRR [sensitive, ls]	361	385	3.6
LRR [sensitive, ls]	386	409	1.8
LRR [sensitive, ls]	386	409	43
LRR [sensitive, ls]	410	433	0.12
LRR [sensitive, ls]	410	433	2.9
LRR [sensitive, ls]	463	486	0.32
LRR [sensitive, ls]	463	486	7.4
LRR [sensitive, ls]	488	511	0.015
LRR [sensitive, ls]	488	511	0.36
LRR [sensitive, ls]	512	535	0.0097
LRR [sensitive, ls]	512	535	0.23
LRR [sensitive, ls]	536	559	5.6e-05
LRR [sensitive, ls]	536	559	0.0013
LRR [sensitive, ls]	560	583	0.0059
LRR [sensitive, ls]	560	583	0.14
LRR [sensitive, ls]	584	607	1.3
LRR [sensitive, ls]	584	607	30
LRR [sensitive, ls]	609	632	0.72
LRR [sensitive, ls]	609	632	17
LRR [sensitive, ls]	633	656	0.00063
LRR [sensitive, ls]	633	656	0.015
LRR [sensitive, ls]	657	680	0.4
LRR [sensitive, ls]	657	680	9.3
LRR [sensitive, ls]	681	704	0.55
LRR [sensitive, ls]	681	704	13
LRR [sensitive, ls]	705	728	0.0005
LRR [sensitive, ls]	705	728	0.012

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	100	731	1e-116
CLV2 [A. thaliana]	120	742	1e-61
FLS2 [A.thaliana]	127	739	1e-92
Cf-9 [L. pimpinellifolium]	147	736	2e-56
CLV2 [A. thaliana]	156	590	1e-34
Cf-9 [L. pimpinellifolium]	163	600	1e-42
FLS2 [A.thaliana]	167	331	5e-14
FLS2 [A.thaliana]	170	694	3e-71
Cf-9 [L. pimpinellifolium]	173	698	7e-53
FLS2 [A.thaliana]	173	742	5e-80
FLS2 [A.thaliana]	180	743	7e-91
Cf-9 [L. pimpinellifolium]	190	742	2e-56
FLS2 [A.thaliana]	399	743	6e-49
FLS2 [A.thaliana]	511	743	2e-17
Xa21 [O. sativa]	605	742	6e-18
Xa21 [O. sativa]	613	742	1e-16

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 4159.m00068

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)