Report for 4235.m00202

 > 4235.m00202, length: 1025, copies: 1 

MRSAYHLMPLLAMLLILVLADHTSSTEAVAPAACLPDQAAALLQLKRSFNATIGDYSAAFRSWVAVAGADCCSWD

GVRCGGAGGRVTSLDLSHRDLQAASGLDDALFSLTSLEYLDLSSNDFGKSQMPATGFEKLTGLTHLDLSNTNFAG

LVPAGIGRLTRLSYLDLSTTFFVEELDDEYSITYYYSDTMAQLSESSLETLLANLTNLEELRLGMVVVKNMSSNG

TARWCDAMARSSPKLRVISMPYCSLSGPICHSLSALRSLAVIELHYNHLSGPVPGFLATLSNLSVLQLSNNKFEG

WFPPIIFQHEKLTTINLTKNLGISGNLPNFSGESVLQSISVSNTNFSGTIPSSISNLKSLKKLALGASGFSGVLP

SSIGKMKSLSLLEVSGLDLVGSIPSWISNLTSLNVLKFFTCGLSGPIPSSIGYLTKLTKLALYNCQFSGEIPSLI

LNLTKLETLLLHSNSFVGIVELTSYSKLQNLYVLNLSNNKLIVIDGENNSSLVSYPSISFLRLASCSISSFPNIL

RHLPEITSLDLSYNQLQGAIPQWTWETWTMDFSLLNLSHNNLRSIGPDPLLNLYIEFLDLSFNNFEGTIPIPEQG

SVTLDYSNNRFSSMPMPLNFSTYLMNTVIFKVSRNSLSGYIPPTICDAIKSLQIIDLSYNNLTGSIPSCLMEDVG

ALQVLNLKGNKLDGELPDNIKEGCALSALDFSDNLIQGQLPRSLVACRNLEILDIGNNQISDSFPCWMSKLPVLR

VLVLQSNKFIGQVLDPSYTRYGNNCQFTSLRIADIASNNFSGTLPEEWFKMLRSMMSSSDNGTSVMEHLYPRERY

KFTVAVTYKGSHMTFSKILTSLVLIDVSNNKFHGNIPAGIEELVLLHGLNMSHNVLTGPIPTQFGKLDNLETLDL

SSNKLSGEIPQELASLNFLSILNLSYNMLDGKIPQSLHFSTFSNDSFVGNIGLCGPPLSKQCGYPTEPNMMSHTA

EKNSIDVLLFLFTALGFGICFGITILVIWGGHNRKQPCERAILYIGRIVW

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	111	136	0.083
LRR [Pfam ls]	137	160	0.39
LRR [Pfam ls]	263	286	0.65
LRR [Pfam ls]	335	358	1.4
LRR [Pfam ls]	383	406	5.3
LRR [Pfam ls]	431	454	0.42
LRR [Pfam ls]	480	503	3.9
LRR [Pfam ls]	507	529	1.4
LRR [Pfam ls]	530	554	0.42
LRR [Pfam ls]	651	675	0.11
LRR [Pfam ls]	724	747	0.12
LRR [Pfam ls]	779	803	5.2
LRR [Pfam ls]	846	869	4.1
LRR [Pfam ls]	894	917	0.0014

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	85	110	0.57
LRR [sensitive, ls]	85	110	13
LRR [sensitive, ls]	111	136	0.0037
LRR [sensitive, ls]	111	136	0.083
LRR [sensitive, ls]	137	160	0.017
LRR [sensitive, ls]	137	160	0.39
LRR [sensitive, ls]	239	262	0.32
LRR [sensitive, ls]	239	262	7.3
LRR [sensitive, ls]	263	286	0.029
LRR [sensitive, ls]	263	286	0.65
LRR [sensitive, ls]	287	310	1.9
LRR [sensitive, ls]	287	310	43
LRR [sensitive, ls]	311	334	0.47
LRR [sensitive, ls]	311	334	11
LRR [sensitive, ls]	335	358	0.061
LRR [sensitive, ls]	335	358	1.4
LRR [sensitive, ls]	359	382	1.6
LRR [sensitive, ls]	359	382	37
LRR [sensitive, ls]	383	406	0.24
LRR [sensitive, ls]	383	406	5.3
LRR [sensitive, ls]	407	430	1
LRR [sensitive, ls]	407	430	23
LRR [sensitive, ls]	431	454	0.019
LRR [sensitive, ls]	431	454	0.42
LRR [sensitive, ls]	455	476	0.6
LRR [sensitive, ls]	455	476	13
LRR [sensitive, ls]	480	503	0.17
LRR [sensitive, ls]	480	503	3.9
LRR [sensitive, ls]	507	529	0.062
LRR [sensitive, ls]	507	529	1.4
LRR [sensitive, ls]	530	554	0.019
LRR [sensitive, ls]	530	554	0.42
LRR [sensitive, ls]	556	576	0.29
LRR [sensitive, ls]	556	576	6.6
LRR [sensitive, ls]	579	601	0.8
LRR [sensitive, ls]	579	601	18
LRR [sensitive, ls]	626	650	2.5
LRR [sensitive, ls]	626	650	56
LRR [sensitive, ls]	651	675	0.0051
LRR [sensitive, ls]	651	675	0.11
LRR [sensitive, ls]	676	696	0.34
LRR [sensitive, ls]	676	696	7.6
LRR [sensitive, ls]	700	723	0.76
LRR [sensitive, ls]	700	723	17
LRR [sensitive, ls]	724	747	0.0054
LRR [sensitive, ls]	724	747	0.12
LRR [sensitive, ls]	779	803	0.23
LRR [sensitive, ls]	779	803	5.2
LRR [sensitive, ls]	846	869	0.18
LRR [sensitive, ls]	846	869	4.1
LRR [sensitive, ls]	870	893	0.4
LRR [sensitive, ls]	870	893	8.9
LRR [sensitive, ls]	894	917	6e-05
LRR [sensitive, ls]	894	917	0.0014
LRR [sensitive, ls]	918	941	0.37
LRR [sensitive, ls]	918	941	8.3

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	8	740	2e-50
Cf-9 [L. pimpinellifolium]	31	1004	1e-100
CLV2 [A. thaliana]	36	713	4e-47
FLS2 [A.thaliana]	90	694	5e-49
Xa21 [O. sativa]	105	595	2e-38
FLS2 [A.thaliana]	167	989	3e-76
Xa21 [O. sativa]	239	763	6e-46
Xa21 [O. sativa]	328	955	3e-49
CLV2 [A. thaliana]	338	962	2e-63
Xa21 [O. sativa]	339	951	2e-42
CLV2 [A. thaliana]	383	957	8e-33
Xa21 [O. sativa]	431	943	8e-40

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	983	1005	out -> in

Report for 4235.m00202

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)