Report for 4241.m00210

 > 4241.m00210, length: 731, copies: 2 

MRPFHFPCSRISSKLPTDLLGFALLTVLCLASSTDSCIDQEKSVLLQFLAGLSGDGGLSASWRNGTNCCTWEGIT

CNADMRIADILLASKALEGQISPSLGSLTGLLQLNLSHNSLSGELPLEGLVSSSSIVVLDVSFNHFSGALQELFI

QSTIWPLQVLNISSNLFTGKFPTTTCKVMNNLVALNASNNSFIGQIPSSLCINSPSFGVLDLSSNQFGGSIPSDI

GNCSMLRVLKGGRNNFKGPLPDELFNASSLEHLSFPNNDLNGVLDDANIIKLSKLSILDLQQNIFSGNIPKSIGQ

LKRLKELHLGENYLYGELPSTLGNCTNLKILDLKINYLSGDLGKINFSSLSNLMIIDLLVNNFNGTIPESIYDCT

NLIALRLSWNKFHGEFSHRMDRLRSLSCLSVGWNDFTNITKALYILKSFSNLKTLLLGGNFNHETLLADETMDGF

ENLQYLEISGSSLHGKISLWLSKLTKLKVLQLSNNQLSGSVPAWINSLNFLFYLDISNNNLTGEFPTILTQIPML

KSDKRTNLDVSVPNMRFYGIPFIKNRQYQYIHTTINIAKNGFTGAIPPEISQLKALDMLNLSFNSFSGETPQAIC

NLTKLVMLDLSNNNLTGTIPLELNKLNFLSAFNVYNNDLEGAIPTGGQFDTFDNSSFTGNPKLCGGMLSHHCNSA

RALPSPTSSTDQFGDKVIFGITFGLFFAYGVLLDQMVLKRLRSLQGILIFQLYEQS

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	105	126	6.6
LRR [Pfam ls]	181	205	5.7
LRR [Pfam ls]	206	229	1.9
LRR [Pfam ls]	279	302	3.9
LRR [Pfam ls]	303	326	1.6
LRR [Pfam ls]	452	475	0.84
LRR [Pfam ls]	476	499	0.06
LRR [Pfam ls]	500	523	5.6
LRR [Pfam ls]	580	603	8.8
LRR [Pfam ls]	604	627	0.0088

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	105	126	0.32
LRR [sensitive, ls]	105	126	6.6
LRR [sensitive, ls]	130	153	0.84
LRR [sensitive, ls]	130	153	17
LRR [sensitive, ls]	156	180	0.53
LRR [sensitive, ls]	156	180	11
LRR [sensitive, ls]	181	205	0.27
LRR [sensitive, ls]	181	205	5.7
LRR [sensitive, ls]	206	229	0.093
LRR [sensitive, ls]	206	229	1.9
LRR [sensitive, ls]	254	278	1.6
LRR [sensitive, ls]	254	278	34
LRR [sensitive, ls]	279	302	0.19
LRR [sensitive, ls]	279	302	3.9
LRR [sensitive, ls]	303	326	0.075
LRR [sensitive, ls]	303	326	1.6
LRR [sensitive, ls]	327	354	0.56
LRR [sensitive, ls]	327	354	12
LRR [sensitive, ls]	376	402	4
LRR [sensitive, ls]	376	402	84
LRR [sensitive, ls]	452	475	0.04
LRR [sensitive, ls]	452	475	0.84
LRR [sensitive, ls]	476	499	0.0029
LRR [sensitive, ls]	476	499	0.06
LRR [sensitive, ls]	500	523	0.27
LRR [sensitive, ls]	500	523	5.6
LRR [sensitive, ls]	580	603	0.42
LRR [sensitive, ls]	580	603	8.8
LRR [sensitive, ls]	604	627	0.00042
LRR [sensitive, ls]	604	627	0.0088
LRR [sensitive, ls]	628	661	4.4
LRR [sensitive, ls]	628	661	92

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	11	671	2e-59
CLV2 [A. thaliana]	22	675	3e-53
FLS2 [A.thaliana]	39	644	2e-60
Cf-9 [L. pimpinellifolium]	61	660	1e-39
FLS2 [A.thaliana]	80	665	2e-63
Cf-9 [L. pimpinellifolium]	100	681	9e-55
CLV2 [A. thaliana]	456	701	3e-13
FLS2 [A.thaliana]	480	660	4e-11

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 4241.m00210

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)