Report for 4274.m00150

 > 4274.m00150, length: 718, copies: 1 

MDLLGFAVVLLLSLASSTSSCKDHEKSFFLQFLAGLSEDGGLAVSWQNDTDCCTWEGITCGTDATITEISLVSKG

LEGHISPYLGNLTGLMRLNLSHNLLSGELPLEELVSSTSLVILDISFNHLSGALQEFSAQISETTIRPLQVLNIS

SNLFTAQFPTNTWKVMNNLVALNASNNSFTGQAPSSFCISAPSITELDLSFNRFGGSVPQDIGNCSMLRVLKGGH

NNFHGALPDELFNASSLEYLSFPDNVLNGVLDDANIIKLRKLSILDLERNMFIGKIPNSIGQLKRLEELHLGHNN

MYGELPLTLGNCTNLKILDLKINYLSGDLGKINFSSLSNLMIIDLLVNNFNGTIPESIYDCTNLIALRLSWNKFH

GEFSQRMDRLRSLSFLSVGGNAFANIRNALHIFKSFRNLTVLSIEQNFMHEILPEDETIDGFESLQHLEIYGSSL

SGKMPVWLSKLKNLEKLFLYDNRLTGTVPVWINKLNFLICLDISNNSFTGEILMTLIQMPMLKSEKTVANIDARV

LILPTYMSSKKDLPALKDWKYEYRILRAEVNVARNGFTSVIPPEIGRLKALDMLDLSFNSFSGEIPQAICNLTNL

EMLDLSSNNLMGAIPLELNKLHFLSAFNVSNNDLEGPIPTGGQFDTFDNSSFIGNPKLCGGMLSHHCNSAKAVHA

PASTLSTDQFSDKVIFGVAFGLFFALGVLLDQIVLSKLRFLQF

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	193	216	0.19
LRR [Pfam ls]	266	289	3.8
LRR [Pfam ls]	290	313	1.5
LRR [Pfam ls]	439	462	0.59
LRR [Pfam ls]	463	486	0.11
LRR [Pfam ls]	575	598	0.33
LRR [Pfam ls]	599	622	0.17

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	89	113	0.52
LRR [sensitive, ls]	89	113	11
LRR [sensitive, ls]	114	136	0.64
LRR [sensitive, ls]	114	136	13
LRR [sensitive, ls]	143	167	0.57
LRR [sensitive, ls]	143	167	12
LRR [sensitive, ls]	168	192	0.91
LRR [sensitive, ls]	168	192	19
LRR [sensitive, ls]	193	216	0.0091
LRR [sensitive, ls]	193	216	0.19
LRR [sensitive, ls]	241	265	3.1
LRR [sensitive, ls]	241	265	65
LRR [sensitive, ls]	266	289	0.18
LRR [sensitive, ls]	266	289	3.8
LRR [sensitive, ls]	290	313	0.071
LRR [sensitive, ls]	290	313	1.5
LRR [sensitive, ls]	314	341	0.56
LRR [sensitive, ls]	314	341	12
LRR [sensitive, ls]	363	386	5.4
LRR [sensitive, ls]	363	386	110
LRR [sensitive, ls]	387	409	3.2
LRR [sensitive, ls]	387	409	66
LRR [sensitive, ls]	413	433	6
LRR [sensitive, ls]	413	433	120
LRR [sensitive, ls]	439	462	0.029
LRR [sensitive, ls]	439	462	0.59
LRR [sensitive, ls]	463	486	0.0053
LRR [sensitive, ls]	463	486	0.11
LRR [sensitive, ls]	487	510	3.7
LRR [sensitive, ls]	487	510	76
LRR [sensitive, ls]	575	598	0.016
LRR [sensitive, ls]	575	598	0.33
LRR [sensitive, ls]	599	622	0.0079
LRR [sensitive, ls]	599	622	0.17
LRR [sensitive, ls]	623	656	4.3
LRR [sensitive, ls]	623	656	89

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	3	666	1e-57
FLS2 [A.thaliana]	32	700	9e-59
Cf-9 [L. pimpinellifolium]	44	647	2e-36
CLV2 [A. thaliana]	60	502	4e-35
CLV2 [A. thaliana]	61	492	5e-28
FLS2 [A.thaliana]	61	660	9e-61
Xa21 [O. sativa]	61	564	1e-41
CLV2 [A. thaliana]	73	670	2e-45
Cf-9 [L. pimpinellifolium]	84	704	1e-56
CLV2 [A. thaliana]	169	640	2e-35

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	689	711	out -> in

Report for 4274.m00150

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)