Report for 4274.m00151

 > 4274.m00151, length: 636, copies: 1 

MSILCLVLVLMLSSASSTSCCTERENNCLLQFLAGLSQDGGLAASWRLGTDCCSWEGITCSSMVSKDAMVTDVLL

ASKRLEGSISPALGRLPGLLRLNLSHNSLSGGLPSEVMSSGSIIILDVSFNSLGRILPLSPPLTTGLKLPLQVLN

ISSNKFSTELPSLDGMAHLITLSASNNRFSGHIPTNFCTNLPSLAVLELSYNQFSGSIPPGLGNCSRLRVLKTNS

SMLSTSIECLSFPNDNLHGTLEGENVIKLGKLATLDLGENNFSGNIPESIGQLNRLEELLLNNNKMYGGIPSTLS

NCTSLITINLRSNNFSGELVNVNFSNLPNLKALDLLWNNFSGSFPNCLLLIYGKIPRWLSKLSSLEMLILNRNQL

TGPIPDWISSLNFLFYLDISNNNLTGEIPTALVQMPMLRSEKSAVQVQLHPRAFQLPIYSLTSLLQYRKANAFPI

MLDLGSNKFTGLIPPEIGQLKGLLELNLSANKLYGDIPQSICNLTNLLTLDLSSNKLSGTIPAALKNLNFLTRFN

ISYNDLEGPIPTEGQLSTFTDCFIGNPKLCGPMLSHRCSSAKAVPAPASTLSTGEFSDKVIFGITVGLFFALGVL

LDQMVFSRMNIPDDGHYSNPSKFRVNLPLLELVCTL

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	93	114	0.86
LRR [Pfam ls]	145	167	5.6
LRR [Pfam ls]	168	192	0.53
LRR [Pfam ls]	193	216	0.02
LRR [Pfam ls]	256	279	0.67
LRR [Pfam ls]	280	303	1.2
LRR [Pfam ls]	304	328	2.6
LRR [Pfam ls]	364	387	0.064
LRR [Pfam ls]	388	411	0.38
LRR [Pfam ls]	472	495	1.8
LRR [Pfam ls]	496	519	0.0042

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	93	114	0.041
LRR [sensitive, ls]	93	114	0.86
LRR [sensitive, ls]	117	139	1.5
LRR [sensitive, ls]	117	139	31
LRR [sensitive, ls]	145	167	0.27
LRR [sensitive, ls]	145	167	5.6
LRR [sensitive, ls]	168	192	0.026
LRR [sensitive, ls]	168	192	0.53
LRR [sensitive, ls]	193	216	0.00094
LRR [sensitive, ls]	193	216	0.02
LRR [sensitive, ls]	256	279	0.032
LRR [sensitive, ls]	256	279	0.67
LRR [sensitive, ls]	280	303	0.059
LRR [sensitive, ls]	280	303	1.2
LRR [sensitive, ls]	304	328	0.12
LRR [sensitive, ls]	304	328	2.6
LRR [sensitive, ls]	329	349	5
LRR [sensitive, ls]	329	349	100
LRR [sensitive, ls]	364	387	0.0031
LRR [sensitive, ls]	364	387	0.064
LRR [sensitive, ls]	388	411	0.018
LRR [sensitive, ls]	388	411	0.38
LRR [sensitive, ls]	448	471	2
LRR [sensitive, ls]	448	471	43
LRR [sensitive, ls]	472	495	0.086
LRR [sensitive, ls]	472	495	1.8
LRR [sensitive, ls]	496	519	0.0002
LRR [sensitive, ls]	496	519	0.0042
LRR [sensitive, ls]	520	542	1.6
LRR [sensitive, ls]	520	542	33

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	2	596	1e-52
CLV2 [A. thaliana]	29	569	4e-39
Xa21 [O. sativa]	29	536	7e-49
Cf-9 [L. pimpinellifolium]	45	537	3e-41
Cf-9 [L. pimpinellifolium]	56	345	2e-16
FLS2 [A.thaliana]	62	316	4e-18
Xa21 [O. sativa]	64	556	2e-48
Cf-9 [L. pimpinellifolium]	65	600	1e-46
CLV2 [A. thaliana]	75	600	6e-46
FLS2 [A.thaliana]	79	556	5e-54
Xa21 [O. sativa]	141	556	2e-41

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	585	607	out -> in

Report for 4274.m00151

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)