Report for 4274.m00152

 > 4274.m00152, length: 359, copies: 1 

MSGELPSALGNCTNLKIINLKYNSFRGELLKLSPRIGNLKSLLFLSLSNNAFVNIANVIHALKNSRKINTLIIGT

NFKGETMPEDIPITDGFQSLQVLSIPSCSLSGKIPLWLSKLAKLEVLDLSNNQLTGPIPDWIHDLNFLYFIDISN

NKLTGDLPTAIMLMPMLQPDKVATQLDPRAFEQPVYAGPSLTYGKNNALPAMLNLANNELTGAIPSEVGQLKSLT

LLNLSFNSLSGQIPQQLFDLTNLQVVDLSNNHLSGSIPPGLNNLHFLTTFDASNNDLEGWIPAGVQSSYPYDFSG

NPKLCDPTLTRTCDSAEAPPVSTLTGEETTPKIVFAIAFGAFFCLGVVYDQAVLSRFFG

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	41	63	3
LRR [Pfam ls]	94	117	7.3
LRR [Pfam fs]	118	141	1.3e-05
LRR [Pfam ls]	118	141	0.00021
LRR [Pfam ls]	142	165	5.5
LRR [Pfam ls]	223	246	0.096
LRR [Pfam fs]	247	270	3.2e-05
LRR [Pfam ls]	247	270	0.00053

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	14	40	0.69
LRR [sensitive, ls]	14	40	14
LRR [sensitive, ls]	41	63	0.15
LRR [sensitive, ls]	41	63	3
LRR [sensitive, ls]	94	117	0.35
LRR [sensitive, ls]	94	117	7.3
LRR [sensitive, ls]	118	141	9.9e-06
LRR [sensitive, ls]	118	141	0.00021
LRR [sensitive, ls]	142	165	0.27
LRR [sensitive, ls]	142	165	5.5
LRR [sensitive, ls]	199	222	1.5
LRR [sensitive, ls]	199	222	32
LRR [sensitive, ls]	223	246	0.0046
LRR [sensitive, ls]	223	246	0.096
LRR [sensitive, ls]	247	270	2.5e-05
LRR [sensitive, ls]	247	270	0.00053
LRR [sensitive, ls]	271	302	4.5
LRR [sensitive, ls]	271	302	94

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	1	331	3e-25
Cf-9 [L. pimpinellifolium]	1	287	4e-19
CLV2 [A. thaliana]	1	316	1e-26
FLS2 [A.thaliana]	1	288	9e-29
FLS2 [A.thaliana]	1	305	8e-28
FLS2 [A.thaliana]	1	293	1e-27
FLS2 [A.thaliana]	1	289	2e-24
Xa21 [O. sativa]	1	288	6e-21
Xa21 [O. sativa]	1	263	5e-18
Xa21 [O. sativa]	1	292	9e-17
Xa21 [O. sativa]	1	290	6e-16
CLV2 [A. thaliana]	2	287	9e-27
CLV2 [A. thaliana]	2	301	4e-23
FLS2 [A.thaliana]	2	292	3e-21
CLV2 [A. thaliana]	3	284	4e-22
Xa21 [O. sativa]	3	287	2e-29
Xa21 [O. sativa]	3	263	1e-19
Cf-9 [L. pimpinellifolium]	7	290	9e-13
Cf-9 [L. pimpinellifolium]	10	287	1e-15
Xa21 [O. sativa]	32	287	1e-15
Xa21 [O. sativa]	87	290	9e-20
Cf-9 [L. pimpinellifolium]	92	333	3e-17
CLV2 [A. thaliana]	94	287	8e-14
FLS2 [A.thaliana]	95	288	2e-21
Xa21 [O. sativa]	98	295	8e-19
FLS2 [A.thaliana]	122	287	8e-17

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	333	355	out -> in

Report for 4274.m00152

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)