Report for 4274.m00156

 > 4274.m00156, length: 710, copies: 1 

MPTLCLVLALILFSASSISCCTDHERNCLLQFLAGLSQDGHGGLAASWPQGTDCCSWEGITCSSSTASKAVTITD

ILLASKKLEGSISPALGRLPGLQRLNLSHNSLSGGLPAEIMSSDSIVILDISFNLLNGDLQDSPSSSASGRRIQV

INVSSNSFSGRFPFSSWEEMENLVVLNASNNSFTGPMPTFFCIRSSSFAMLDLSYNHFSGNLPPEIGNCSSLRLL

KAGHNSLRGTLPDELFNVTSLEHLSFPNNGLQGVLDGAGMIKLRNLVVLDLGFNMFSGNIPDSIGKLKRLEEIHL

HHNSMAGELTPAIGSCTNLKALNLGSNNFSGELGKVNFSKLSSLKSLHVSYNSFAGTIPESVYTCSNLNALQLSF

NKFHGQLSFRITNLKSLTYLSLAENSFTNISNTLQILKSSRDLTTLLIGGNFRDEEISDDKTVDGFENLKVLAME

NCPLFGNIPIWISKLKNLEMLFLFNNHLSGSIPVWISTLNSLFYLDLSNNSLSGEIPAELTEMPMLRSEMVTSHL

DIKIFELPVYTGPSPKYFTVSDFPAVMILENNKLTGVIPTEIGQLKALLSLILGYNNLHGEIPETILDLTNLEIL

DLSNNHLTGTIPADLNNLNFLSALNVSNNDLQGPVPTGGHLDTFPRSSFDGNPRLCGHILDQDCDDPVMVDSPQG

SSRQGGYKVIFVIAFGAFFGVGVLLDQLCLSRFLG

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	96	119	0.63
LRR [Pfam ls]	172	194	6.6
LRR [Pfam ls]	197	220	2.3
LRR [Pfam ls]	221	244	5.5
LRR [Pfam ls]	270	293	0.058
LRR [Pfam ls]	294	317	8
LRR [Pfam ls]	318	342	0.76
LRR [Pfam ls]	391	413	2.5
LRR [Pfam ls]	467	490	0.54
LRR [Pfam ls]	491	514	0.02
LRR [Pfam fs]	596	619	1.9e-05
LRR [Pfam ls]	596	619	0.0003
LRR [Pfam ls]	620	653	5.9

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	96	119	0.03
LRR [sensitive, ls]	96	119	0.63
LRR [sensitive, ls]	120	144	2.5
LRR [sensitive, ls]	120	144	51
LRR [sensitive, ls]	147	171	0.47
LRR [sensitive, ls]	147	171	9.8
LRR [sensitive, ls]	172	194	0.32
LRR [sensitive, ls]	172	194	6.6
LRR [sensitive, ls]	197	220	0.11
LRR [sensitive, ls]	197	220	2.3
LRR [sensitive, ls]	221	244	0.27
LRR [sensitive, ls]	221	244	5.5
LRR [sensitive, ls]	245	266	1.7
LRR [sensitive, ls]	245	266	34
LRR [sensitive, ls]	270	293	0.0028
LRR [sensitive, ls]	270	293	0.058
LRR [sensitive, ls]	294	317	0.39
LRR [sensitive, ls]	294	317	8
LRR [sensitive, ls]	318	342	0.036
LRR [sensitive, ls]	318	342	0.76
LRR [sensitive, ls]	343	366	0.48
LRR [sensitive, ls]	343	366	10
LRR [sensitive, ls]	367	390	0.89
LRR [sensitive, ls]	367	390	19
LRR [sensitive, ls]	391	413	0.12
LRR [sensitive, ls]	391	413	2.5
LRR [sensitive, ls]	443	466	0.85
LRR [sensitive, ls]	443	466	18
LRR [sensitive, ls]	467	490	0.026
LRR [sensitive, ls]	467	490	0.54
LRR [sensitive, ls]	491	514	0.00098
LRR [sensitive, ls]	491	514	0.02
LRR [sensitive, ls]	548	571	4.4
LRR [sensitive, ls]	548	571	91
LRR [sensitive, ls]	572	595	0.66
LRR [sensitive, ls]	572	595	14
LRR [sensitive, ls]	596	619	1.4e-05
LRR [sensitive, ls]	596	619	0.0003
LRR [sensitive, ls]	620	653	0.29
LRR [sensitive, ls]	620	653	5.9

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	1	659	3e-67
FLS2 [A.thaliana]	4	636	1e-62
Cf-9 [L. pimpinellifolium]	47	636	9e-39
CLV2 [A. thaliana]	51	699	4e-55
FLS2 [A.thaliana]	68	333	2e-23
FLS2 [A.thaliana]	71	657	4e-61
Cf-9 [L. pimpinellifolium]	91	673	4e-52

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	684	706	out -> in

Report for 4274.m00156

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)