Report for 4274.m00157

 > 4274.m00157, length: 698, copies: 1 

MPPFGQALLLLLLCFVCHAGSCTEQERESLLQFLSGLSNDGGLGVSWQNGTDCCTWEGITCSGNGAVVEVISLAS

RGLEGSISPSLGDLTGLLRLNLSRNSLSGGLPLELVSSSSIVVLDVSFNYLTGGLSELPSSTPDRPLQVLNISSN

LFTGNFPSTTWERMNNLVVLNASNNRFTGQMPTSFCASAPSFAVLELSYNQFSGRIPAGLSNCSKLTLLSASYNN

LTGTLPDELFDLTSLKHLCFLRNQLEGSIKGITKLKNLVTIDLGQNRLSGSIPNSIGQLKRLEKLHLAYNSMSGE

LPSTVGNCRNLKNMNLGGNNFSGDLGNVNFSTLRNLQSLDLMSNNFTGTVPESIYSCRNLSALQLSNNSFHGQLS

EKIRNLKCLSFVSLVDISLTNITGSLQILQSCRNLTTLLIGYNFMQETMPEDDEIYGFENLRIFSLNDCSLSGKI

PKWLSKLTNLEMLSLYNNQLNGAIPDWISSLNFLFHIDISNNSLSGEIPSALVEMPMLKSDNVPPKVFELPICTG

YALQYRINSAFPKVLNLGINNFTGIIPNEIGQLKALQLLNLSSNRLSGEIPESIYKLTNLQVLDLSSNNLTGTIP

DGLNKLHFLSAFNISNNDLEGPVPNAGQLSTFPSTSFDGNPKLCGPMLARHCGLAQTPFVSTKQNADKVVSSFVF

MISFGAFFAVGVLYDQIVLSRFF

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	115	137	6.8
LRR [Pfam ls]	166	190	3
LRR [Pfam ls]	191	214	1.6
LRR [Pfam ls]	215	238	0.082
LRR [Pfam ls]	262	285	0.089
LRR [Pfam ls]	286	309	4.7
LRR [Pfam ls]	310	334	3.3
LRR [Pfam ls]	335	358	2.5
LRR [Pfam ls]	359	382	3.7
LRR [Pfam ls]	435	458	0.3
LRR [Pfam ls]	459	482	0.036
LRR [Pfam ls]	483	506	1.7
LRR [Pfam ls]	560	583	0.046
LRR [Pfam fs]	584	607	2.3e-05
LRR [Pfam ls]	584	607	0.00037

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	67	90	5.8
LRR [sensitive, ls]	67	90	120
LRR [sensitive, ls]	91	114	0.61
LRR [sensitive, ls]	91	114	13
LRR [sensitive, ls]	115	137	0.33
LRR [sensitive, ls]	115	137	6.8
LRR [sensitive, ls]	141	165	0.53
LRR [sensitive, ls]	141	165	11
LRR [sensitive, ls]	166	190	0.14
LRR [sensitive, ls]	166	190	3
LRR [sensitive, ls]	191	214	0.078
LRR [sensitive, ls]	191	214	1.6
LRR [sensitive, ls]	215	238	0.004
LRR [sensitive, ls]	215	238	0.082
LRR [sensitive, ls]	239	261	5.8
LRR [sensitive, ls]	239	261	120
LRR [sensitive, ls]	262	285	0.0043
LRR [sensitive, ls]	262	285	0.089
LRR [sensitive, ls]	286	309	0.22
LRR [sensitive, ls]	286	309	4.7
LRR [sensitive, ls]	310	334	0.16
LRR [sensitive, ls]	310	334	3.3
LRR [sensitive, ls]	335	358	0.12
LRR [sensitive, ls]	335	358	2.5
LRR [sensitive, ls]	359	382	0.18
LRR [sensitive, ls]	359	382	3.7
LRR [sensitive, ls]	409	434	5.8
LRR [sensitive, ls]	409	434	120
LRR [sensitive, ls]	435	458	0.015
LRR [sensitive, ls]	435	458	0.3
LRR [sensitive, ls]	459	482	0.0018
LRR [sensitive, ls]	459	482	0.036
LRR [sensitive, ls]	483	506	0.08
LRR [sensitive, ls]	483	506	1.7
LRR [sensitive, ls]	536	559	0.63
LRR [sensitive, ls]	536	559	13
LRR [sensitive, ls]	560	583	0.0022
LRR [sensitive, ls]	560	583	0.046
LRR [sensitive, ls]	584	607	1.8e-05
LRR [sensitive, ls]	584	607	0.00037
LRR [sensitive, ls]	608	641	1.4
LRR [sensitive, ls]	608	641	29

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	1	640	8e-76
Xa21 [O. sativa]	4	685	1e-62
CLV2 [A. thaliana]	25	688	4e-53
FLS2 [A.thaliana]	63	645	9e-69
FLS2 [A.thaliana]	71	640	5e-57
Cf-9 [L. pimpinellifolium]	86	653	4e-61
Xa21 [O. sativa]	195	640	8e-58

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	669	688	out -> in

Report for 4274.m00157

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)