Report for 4274.m00158

 > 4274.m00158, length: 710, copies: 1 

MPYSGLATAALLLLLLIVATSAMACVEQEKSSLLQFLAELSHDGGIAMSWQNGTNCCVWEGITCNEDGAVIEVRL

TSKGLEGQIAPSLGELTSLSRLNLSYNSLSGGLPAELMSSGSIVVLDVSFNRLNGDLQELNPSVSDRPLQVLNIS

SNRFTGEFPSITWEKMRNLVAINASNNSFTGHIPSSFCSNSPSFAVLDLGYNQFSGNIPPGIGKCSALRLLKANA

NNIRGPLPGDLFNATSLEYLSFANNGLQGTIDDALIVKLINLVFVDLGWNRFSGKIPNSIGQLKRLKELHICSNN

LSGELPSSLGDCTKLVTINLRGNKLTGELAKVNYSNLPNLKTLDFASNHFTGKIPESIYSCSNLTWLRLSSNRLH

GQLTKNIQNLNSITFLSLSYNNFTNIKNTLHILKSLRNLNVLLIGGNFMHEAMPQDETIDGFENIFGISIHDCAL

TGKIPSWLSKLGNLAVLDLSNNKLRGPIPTWINSLNFLKYADISNNSLSGEIPQALMEIPMLKSDKIADNSDPRA

FPFPVYAGACLCFQYRTVTAFPKMLNLGNNKFTGAIPMEIGELKALVSLNLSFNNLNREIPQSISNLKNLMVLDL

SYNHLTGAIPPALVNLHFLSEFNVSHNDLKGSVPIGGQFSTFPSSSFAGNPELCSPILLHRCNVAEVDLSSPNST

KEYINKVIFVIAFCVFFGVGVLYDQIVLSRYFRLN

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	93	116	1.2
LRR [Pfam ls]	168	192	0.57
LRR [Pfam ls]	193	216	5
LRR [Pfam ls]	241	265	3.7
LRR [Pfam ls]	266	289	3.1
LRR [Pfam ls]	290	313	0.37
LRR [Pfam ls]	314	338	1.2
LRR [Pfam ls]	339	362	1.5
LRR [Pfam ls]	363	386	2
LRR [Pfam ls]	387	409	3.7
LRR [Pfam ls]	463	486	0.016
LRR [Pfam ls]	570	593	0.52
LRR [Pfam ls]	594	617	0.025

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	93	116	0.059
LRR [sensitive, ls]	93	116	1.2
LRR [sensitive, ls]	117	139	1.4
LRR [sensitive, ls]	117	139	29
LRR [sensitive, ls]	143	167	0.5
LRR [sensitive, ls]	143	167	10
LRR [sensitive, ls]	168	192	0.028
LRR [sensitive, ls]	168	192	0.57
LRR [sensitive, ls]	193	216	0.24
LRR [sensitive, ls]	193	216	5
LRR [sensitive, ls]	217	240	2.2
LRR [sensitive, ls]	217	240	45
LRR [sensitive, ls]	241	265	0.18
LRR [sensitive, ls]	241	265	3.7
LRR [sensitive, ls]	266	289	0.15
LRR [sensitive, ls]	266	289	3.1
LRR [sensitive, ls]	290	313	0.018
LRR [sensitive, ls]	290	313	0.37
LRR [sensitive, ls]	314	338	0.058
LRR [sensitive, ls]	314	338	1.2
LRR [sensitive, ls]	339	362	0.071
LRR [sensitive, ls]	339	362	1.5
LRR [sensitive, ls]	363	386	0.096
LRR [sensitive, ls]	363	386	2
LRR [sensitive, ls]	387	409	0.18
LRR [sensitive, ls]	387	409	3.7
LRR [sensitive, ls]	439	462	1.1
LRR [sensitive, ls]	439	462	23
LRR [sensitive, ls]	463	486	0.00075
LRR [sensitive, ls]	463	486	0.016
LRR [sensitive, ls]	487	510	0.91
LRR [sensitive, ls]	487	510	19
LRR [sensitive, ls]	546	569	1.8
LRR [sensitive, ls]	546	569	37
LRR [sensitive, ls]	570	593	0.025
LRR [sensitive, ls]	570	593	0.52
LRR [sensitive, ls]	594	617	0.0012
LRR [sensitive, ls]	594	617	0.025
LRR [sensitive, ls]	618	651	0.66
LRR [sensitive, ls]	618	651	14

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	27	634	4e-73
CLV2 [A. thaliana]	28	697	5e-62
Xa21 [O. sativa]	29	690	1e-61
Cf-9 [L. pimpinellifolium]	48	653	1e-60
FLS2 [A.thaliana]	72	654	1e-70
FLS2 [A.thaliana]	429	650	5e-12

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	5	27	in -> out
putative TM domain	682	704	out -> in

Report for 4274.m00158

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)