Report for 4279.m00143

 > 4279.m00143, length: 834, copies: 1 

MTAGRFGAARRHGRQARQRLTAAATRRNQLSGHIPQELGYLVDLKNLSLYDNVLTGFIPNNIGNFTKLSILSLSG

NMLTGSIPNSLGNLPRLSTLSVWRNQLSGCISQELGNLVNLENLYLSENMFTGSIPNSLGNLTKLTALHIRSNQL

SGSIPKEISSLMNLNILHIDQNNLSGELPLGLCAGGQLQNFTAQDNNLVGPLPTSLLNCKTLVRVRLERNQLEGD

ISEMGLHPNLVYIDMSSNKLYGQLSHRWGECAKLTTLRASNNRITGVIPSSMGKLSQLGRLDVSSNEIEGHIPPE

IGNVVSLFNLSLANNMLQGTIPKEVGSLQNLEYLDLSSNNLSGQIHGSIENCLKLRLLRLGHNRLDGSIPVKLGM

LVSLQELLDLSDNSFSGIIPSQLGALSMLEALNLSHNTLNGSIPSSFQGMISLSSLDVSYNNLEGPVPHINFLEE

APIEWFMHNKKLCGTVKALPPCDLNQKGGQGKKFKSILLGIVGAAGMSIVFIMSLVAWQCKRKKYGEQSENGVGD

AKVFSVWNFEGGEACRQIFETTKYFNETHCIGTGGNGSVYRAQLPTGEIFAVKKIHMMEYDELIFKREIDALTRI

RHRNIVKLFGYCSAVHGKFLVYEYMDRGSLSRYLENHNIAIELDWMRRISIVKDVANALSYIHHDCFAPIVHRDI

TSNNILLDQEFRACISDFGIAKVLDVEASNCTKLAGTKGYLAPELAYTTRVTEKCDVYSFGVLVFELFMGHHPGD

FLLSFSMAKESTTLKDLLDARIPLPKAETASEIFRVIMAAVQCLDPNPSRRPTMQHVTRMFSTAEGPSNPDHLHV

DIIIPAYYQ

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	43	66	0.22
LRR [Pfam ls]	67	90	0.0066
LRR [Pfam ls]	115	138	0.0036
LRR [Pfam ls]	139	162	1.8
LRR [Pfam ls]	258	281	0.075
LRR [Pfam ls]	282	305	2.1
LRR [Pfam ls]	306	329	3.1
LRR [Pfam ls]	330	353	0.091
LRR [Pfam ls]	354	377	4.9
LRR [Pfam ls]	403	426	0.43
LRR [Pfam ls]	427	449	3.9
Ser/Thr pkinase [Pfam fs]	550	748	1.9e-49
Ser/Thr pkinase [Pfam ls]	550	811	2.2e-51
Ser/Thr pkinase [Pfam fs]	792	811	0.41

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	43	66	0.011
LRR [sensitive, ls]	43	66	0.22
LRR [sensitive, ls]	67	90	0.00032
LRR [sensitive, ls]	67	90	0.0066
LRR [sensitive, ls]	91	114	1
LRR [sensitive, ls]	91	114	22
LRR [sensitive, ls]	115	138	0.00017
LRR [sensitive, ls]	115	138	0.0036
LRR [sensitive, ls]	139	162	0.084
LRR [sensitive, ls]	139	162	1.8
LRR [sensitive, ls]	163	183	0.92
LRR [sensitive, ls]	163	183	19
LRR [sensitive, ls]	187	210	2.7
LRR [sensitive, ls]	187	210	57
LRR [sensitive, ls]	211	232	2.6
LRR [sensitive, ls]	211	232	54
LRR [sensitive, ls]	234	257	1.7
LRR [sensitive, ls]	234	257	36
LRR [sensitive, ls]	258	281	0.0036
LRR [sensitive, ls]	258	281	0.075
LRR [sensitive, ls]	282	305	0.1
LRR [sensitive, ls]	282	305	2.1
LRR [sensitive, ls]	306	329	0.15
LRR [sensitive, ls]	306	329	3.1
LRR [sensitive, ls]	330	353	0.0044
LRR [sensitive, ls]	330	353	0.091
LRR [sensitive, ls]	354	377	0.24
LRR [sensitive, ls]	354	377	4.9
LRR [sensitive, ls]	378	402	2.8
LRR [sensitive, ls]	378	402	58
LRR [sensitive, ls]	403	426	0.021
LRR [sensitive, ls]	403	426	0.43
LRR [sensitive, ls]	427	449	0.19
LRR [sensitive, ls]	427	449	3.9

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	12	443	9e-37
Xa21 [O. sativa]	13	464	6e-61
CLV2 [A. thaliana]	16	418	5e-37
Cf-9 [L. pimpinellifolium]	18	503	3e-43
FLS2 [A.thaliana]	18	819	1e-116
CLV2 [A. thaliana]	19	278	2e-18
Xa21 [O. sativa]	19	634	1e-76
Cf-9 [L. pimpinellifolium]	20	443	3e-41
FLS2 [A.thaliana]	26	468	2e-66
CLV2 [A. thaliana]	27	455	2e-40
CLV2 [A. thaliana]	28	375	3e-33
FLS2 [A.thaliana]	28	443	2e-71
FLS2 [A.thaliana]	28	469	3e-59
FLS2 [A.thaliana]	29	466	4e-56
Cf-9 [L. pimpinellifolium]	30	449	1e-46
CLV2 [A. thaliana]	30	446	6e-46
CLV2 [A. thaliana]	32	442	2e-42
FLS2 [A.thaliana]	46	469	8e-57
FLS2 [A.thaliana]	234	443	2e-27
Pto [L. esculentum]	545	807	3e-28
Rpg1 [Hordeum vulgare]	547	812	3e-33
Rpg1 [Hordeum vulgare]	547	807	5e-28

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	486	508	out -> in

Report for 4279.m00143

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)