Report for 4285.m00107

 > 4285.m00107, length: 1007, copies: 2 

MPPPSLLLPPLLLLLGLHAAAAAVSEVSALMAFKNALTIPPTAAAFFARWDAAAASPCNFTGVDCANSGGGGVTA

VAVEGLGVAATSVPFDVLCGSLPSLAKLSLPSNALAGGIGGVAGCTALEVLDLAFNGFSGHVPDLSPLTRLQRLN

VSQNSFTGAFPWRALASMPGLTVLAAGDNGFFEKTETFPDEITALTNLTVLYLSAANIGGVIPPGIGNLAKLVDL

ELSDNALTGEIPPEITKLTNLLQLELYNNSLHGELPAGFGNLTKLQFFDASMNHLTGSLSELRSLTQLVSLQLFY

NGFTGDVPPEFGEFKELVNLSLYNNNLTGELPRDLGSWAEFNFIDVSTNALSGPIPPFMCKRGKMTRLLMLENNF

SGQIPATYANCTTLVRFRVSKNSMSGDVPDGLWALPNVDIIDLANNQFTGGIGDGIGRAALLSSLDLAGNRFSGA

IPPSIGDASNLETIDISSNGLSGKIPASIGRLARLGSLNIARNGITGAIPASIGECSSLSTVNFTGNKLAGAIPS

ELGTLPRLNSLDLSGNDLSGAVPASLAALKLSSLNMSDNKLVGPVPEPLSIAAYGESFKGNPGLCATNGVDFLRR

CSPGSGGHSAATARTVVTCLLAGLAVVLAALGAVMYIKKRRRAEAEAEEAAGGKVFGKKGSWDLKSFRVLAFDEH

EVIDGVRDENLIGSGGSGNVYRVKLGSGAVVAVKHITRTRAAAAAARSTAASAAMLRSPSAARRTASVRCREFDS

EVGTLSSIRHVNVVKLLCSITSDDGAASLLVYEHLPNGSLYERLHEGQKLGGRGGLGWPERYDIAVGAARGLEYL

HHGCDRPILHRDVKSSNILLDESFKPRIADFGLAKILDGAAATPDTTSAGVVAGTLGYMAPEYSYTWKVTEKSDV

YSFGVVLLELVTGRTAIMAEYGESRDIVEWVSRRLDSRDKVMSLLDASIGEEWEKEEAVRVLRVAVVCTSRTPSM

RPSMRSVVQMLEAAAIGREFAVVTSVKVKVIP

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	122	144	0.41
LRR [Pfam ls]	145	169	0.21
LRR [Pfam ls]	197	220	0.62
LRR [Pfam ls]	221	244	0.0066
LRR [Pfam ls]	245	268	0.016
LRR [Pfam ls]	292	315	0.48
LRR [Pfam ls]	316	339	0.14
LRR [Pfam ls]	436	459	5.1
LRR [Pfam ls]	460	483	0.11
LRR [Pfam ls]	508	531	4.8
LRR [Pfam ls]	532	552	2.9
Ser/Thr pkinase [Pfam fs]	681	917	4.5e-41
Ser/Thr pkinase [Pfam ls]	681	988	8.8e-38

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	99	121	2.2
LRR [sensitive, ls]	99	121	49
LRR [sensitive, ls]	122	144	0.018
LRR [sensitive, ls]	122	144	0.41
LRR [sensitive, ls]	145	169	0.0095
LRR [sensitive, ls]	145	169	0.21
LRR [sensitive, ls]	197	220	0.028
LRR [sensitive, ls]	197	220	0.62
LRR [sensitive, ls]	221	244	0.00029
LRR [sensitive, ls]	221	244	0.0066
LRR [sensitive, ls]	245	268	0.00073
LRR [sensitive, ls]	245	268	0.016
LRR [sensitive, ls]	269	291	0.84
LRR [sensitive, ls]	269	291	19
LRR [sensitive, ls]	292	315	0.021
LRR [sensitive, ls]	292	315	0.48
LRR [sensitive, ls]	316	339	0.0063
LRR [sensitive, ls]	316	339	0.14
LRR [sensitive, ls]	388	411	1.4
LRR [sensitive, ls]	388	411	32
LRR [sensitive, ls]	412	435	0.96
LRR [sensitive, ls]	412	435	22
LRR [sensitive, ls]	436	459	0.23
LRR [sensitive, ls]	436	459	5.1
LRR [sensitive, ls]	460	483	0.0047
LRR [sensitive, ls]	460	483	0.11
LRR [sensitive, ls]	484	507	0.45
LRR [sensitive, ls]	484	507	10
LRR [sensitive, ls]	508	531	0.21
LRR [sensitive, ls]	508	531	4.8
LRR [sensitive, ls]	532	552	0.13
LRR [sensitive, ls]	532	552	2.9
LRR [sensitive, ls]	555	575	0.3
LRR [sensitive, ls]	555	575	6.6

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	23	795	2e-70
FLS2 [A.thaliana]	26	574	2e-71
Cf-9 [L. pimpinellifolium]	29	572	5e-42
CLV2 [A. thaliana]	55	590	6e-47
Cf-9 [L. pimpinellifolium]	81	589	4e-44
FLS2 [A.thaliana]	95	986	1e-106
FLS2 [A.thaliana]	280	576	3e-42
CLV2 [A. thaliana]	330	564	3e-17
Cf-9 [L. pimpinellifolium]	376	574	1e-10
Rpg1 [Hordeum vulgare]	663	991	3e-25
Pto [L. esculentum]	665	989	2e-37
Rpg1 [Hordeum vulgare]	675	996	7e-17

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	615	637	out -> in

Report for 4285.m00107

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)