Report for 4316.m00155

 > 4316.m00155, length: 640, copies: 1 

MLTGSLPVELSLLRNLSSLDMNRNRFSGPIPPEIGKFRSIERLILSENYFVGQIPPGIGNLTKLVAFNISSNQLT

GPIPRELARCTKLQRLDLSKNSLTGVIPQELGTLVNLEQLKLSDNSLNGTVPSSFGGLSRLTELQMGGNRLSGQL

PVELGQLTALQIALNVSYNMLSGEIPTQLGNLHMLEFLYLNNNELEGEVPSSFGELSSLLECNLSYNNLAGPLPS

TTLFQHMDSSNFLGNNGLCGIKGKSCSGLSGSAYASREAAVQKKRLLREKIISISSIVIAFVSLVLIAVVCWSLK

SKIPDLVSNEERKTGFSGPHYFLKERITFQELMKVTDSFSESAVIGRGACGTVYKAIMPDGRRVAVKKLKCQGEG

SNVDRSFRAEITTLGNVRHRNIVKLYGFCSNQDCNLILYEYMANGSLGELLHGSKDVCLLDWDTRYRIALGAAEG

LRYLHSDCKPKVIHRDIKSNNILLDEMMEAHVGDFGLAKLIDISNSRTMSAIAGSYGYIAPEYAFTMKVTEKCDI

YSFGVVLLELVTGQSPIQPLEQGGDLVNLVRRMTNSSTTNSEIFDSRLNLNSRRVLEEISLVLKIALFCTSESPL

DRPSMREVISMLMDARASAYDSFSSPASEAPIEDDSSLKH

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	15	38	1.5
LRR [Pfam ls]	39	62	0.23
LRR [Pfam ls]	87	110	0.025
LRR [Pfam ls]	111	134	0.013
LRR [Pfam ls]	135	158	0.24
LRR [Pfam ls]	184	207	0.17
Ser/Thr pkinase [Pfam fs]	339	541	3.2e-50
Ser/Thr pkinase [Pfam ls]	339	614	3.4e-48

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	15	38	0.075
LRR [sensitive, ls]	15	38	1.5
LRR [sensitive, ls]	39	62	0.011
LRR [sensitive, ls]	39	62	0.23
LRR [sensitive, ls]	63	86	0.46
LRR [sensitive, ls]	63	86	9.6
LRR [sensitive, ls]	87	110	0.0012
LRR [sensitive, ls]	87	110	0.025
LRR [sensitive, ls]	111	134	0.00062
LRR [sensitive, ls]	111	134	0.013
LRR [sensitive, ls]	135	158	0.011
LRR [sensitive, ls]	135	158	0.24
LRR [sensitive, ls]	184	207	0.0083
LRR [sensitive, ls]	184	207	0.17

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	1	221	4e-21
FLS2 [A.thaliana]	1	225	4e-34
FLS2 [A.thaliana]	1	223	2e-29
FLS2 [A.thaliana]	1	144	5e-19
Cf-9 [L. pimpinellifolium]	2	253	5e-23
Cf-9 [L. pimpinellifolium]	2	245	1e-21
Cf-9 [L. pimpinellifolium]	2	263	9e-21
CLV2 [A. thaliana]	2	225	5e-22
CLV2 [A. thaliana]	2	221	9e-19
FLS2 [A.thaliana]	2	629	3e-96
FLS2 [A.thaliana]	2	226	2e-38
FLS2 [A.thaliana]	2	224	8e-38
FLS2 [A.thaliana]	2	224	1e-37
FLS2 [A.thaliana]	2	261	5e-35
FLS2 [A.thaliana]	2	226	6e-34
FLS2 [A.thaliana]	2	238	1e-29
Xa21 [O. sativa]	2	226	6e-29
Xa21 [O. sativa]	2	427	1e-54
Xa21 [O. sativa]	2	214	1e-28
CLV2 [A. thaliana]	3	245	2e-26
CLV2 [A. thaliana]	3	200	2e-24
Cf-9 [L. pimpinellifolium]	6	235	9e-26
Cf-9 [L. pimpinellifolium]	13	241	6e-19
Xa21 [O. sativa]	19	224	7e-31
Xa21 [O. sativa]	40	246	1e-31
FLS2 [A.thaliana]	45	225	2e-24
CLV2 [A. thaliana]	63	224	3e-14
Xa21 [O. sativa]	63	234	5e-25
FLS2 [A.thaliana]	64	224	3e-22
Pto [L. esculentum]	322	609	7e-40
Rpg1 [Hordeum vulgare]	329	612	6e-41
Rpg1 [Hordeum vulgare]	332	612	2e-30

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	277	299	out -> in

Report for 4316.m00155

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)