Report for 4320.m00158

 > 4320.m00158, length: 931, copies: 2 

MTPAPAAASYRALVALLLVAVAVADDGSTLLEIKKSFRNVDNVLYDWAGGDYCSWRGVLCDNVTFAVAALNLSGL

NLGGEISPAVGRLKGIVSMYGRRGGVLCCCLEMWLAGAWTRSNFDLKSNGLSGQIPDEIGDCSSLKTLILKNNQL

IGVIPSTLSQLPNLKILDLAQNKLSGEIPRLIYWNEVLQYLGLRGNNLEGSISPDICQLTGLWYLDLSYNKLSGS

IPFNIGFLQVATLSLQGNMFTGPIPSVIGLMQALAVLDLSYNQLSGPIPSILGNLTYTEKLYMQGNKLTGPIPPE

LGNMSTLHYLELNDNQLSGFIPPEFGKLTGLFDLNLANNNFEGPIPDNISSCVNLNSFNAYGNRLNGTIPPSLHK

LESMTYLNLSSNFLSGSIPIELSRINNLDTFNLSNNGLVGFIPAEIGNLRSIMEIDMSNNHLGGLIPQELGMLQN

LMLLNLKNNNITGDVSSLMNCFSLNILNVSYNNLAGVVPTDNNFSRFSPDSFLGNPGLCGYWLGSSCRSSGHQQK

PLISKAAILGIAVGGLVILLMILVAVCRPHSPPVFKDVSVSKPVSNVPPKLVILHMNLSLLVYEDIMTMTENLSE

KYIIGYGASSTVYKCVSKNRKPVAVKKLYAHYPQSFKEFETELETVGSIKHRNLVSLQGYSLSPVGNLLFYDYME

NGSLWDVLHEGPTKKKKLDWETRLRIALGAAQGLAYLHHDCSPRIIHRDVKSKNILLDKDYEAHLTDFGIAKSLC

VSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECNLHHLILSKTANNAVMETVDP

DIADTCKDLGEVKKVFQLALLCTKRQPSDRPTMHEVVRVLDCLVRPDPPPKSAQQLAMPQRPAVPSYINEYVSLR

GTSVLSCANSSCTSDAELFLKFGEVISQNTE

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	139	162	0.18
LRR [Pfam ls]	163	185	2.3
LRR [Pfam ls]	187	210	0.18
LRR [Pfam ls]	211	231	6.4
LRR [Pfam ls]	234	257	6.6
LRR [Pfam ls]	258	281	0.0099
LRR [Pfam ls]	282	305	6
LRR [Pfam ls]	306	329	0.006
LRR [Pfam ls]	354	377	1.7
LRR [Pfam ls]	378	401	2.1
LRR [Pfam ls]	402	425	0.49
Ser/Thr pkinase [Pfam fs]	598	862	1.2e-41
Ser/Thr pkinase [Pfam ls]	598	862	4.8e-41

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	66	89	1.9
LRR [sensitive, ls]	66	89	44
LRR [sensitive, ls]	139	162	0.0075
LRR [sensitive, ls]	139	162	0.18
LRR [sensitive, ls]	163	185	0.1
LRR [sensitive, ls]	163	185	2.3
LRR [sensitive, ls]	187	210	0.0076
LRR [sensitive, ls]	187	210	0.18
LRR [sensitive, ls]	211	231	0.28
LRR [sensitive, ls]	211	231	6.4
LRR [sensitive, ls]	234	257	0.28
LRR [sensitive, ls]	234	257	6.6
LRR [sensitive, ls]	258	281	0.00043
LRR [sensitive, ls]	258	281	0.0099
LRR [sensitive, ls]	282	305	0.26
LRR [sensitive, ls]	282	305	6
LRR [sensitive, ls]	306	329	0.00026
LRR [sensitive, ls]	306	329	0.006
LRR [sensitive, ls]	330	353	0.32
LRR [sensitive, ls]	330	353	7.5
LRR [sensitive, ls]	354	377	0.075
LRR [sensitive, ls]	354	377	1.7
LRR [sensitive, ls]	378	401	0.092
LRR [sensitive, ls]	378	401	2.1
LRR [sensitive, ls]	402	425	0.021
LRR [sensitive, ls]	402	425	0.49
LRR [sensitive, ls]	426	449	0.52
LRR [sensitive, ls]	426	449	12
LRR [sensitive, ls]	450	472	0.57
LRR [sensitive, ls]	450	472	13
LRR [sensitive, ls]	473	506	0.44
LRR [sensitive, ls]	473	506	10

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	15	501	5e-57
CLV2 [A. thaliana]	26	505	2e-54
FLS2 [A.thaliana]	31	488	2e-62
Cf-9 [L. pimpinellifolium]	53	489	4e-35
Xa21 [O. sativa]	66	684	9e-60
Cf-9 [L. pimpinellifolium]	70	546	7e-44
FLS2 [A.thaliana]	117	502	6e-62
FLS2 [A.thaliana]	117	322	1e-26
FLS2 [A.thaliana]	118	862	2e-93
FLS2 [A.thaliana]	145	489	5e-48
Cf-9 [L. pimpinellifolium]	234	491	1e-18
FLS2 [A.thaliana]	235	494	6e-39
CLV2 [A. thaliana]	310	490	1e-14
Rpg1 [Hordeum vulgare]	588	930	5e-34
Pto [L. esculentum]	589	870	2e-44
Rpg1 [Hordeum vulgare]	593	866	4e-24

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	7	24	in -> out
putative TM domain	7	24	in -> out

Report for 4320.m00158

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)