Report for 4356.m00190

 > 4356.m00190, length: 967, copies: 2 

MAIKRTWQLWLLSLLTHAILLFTASSQSINGDDLSALLSFKSLIRNDPREVLSSWDTSSNTTNMTAPVFCRWTGI

SCNDRRHPGRVTTLNLSDAGLVGTISQQLGNLTHLRVLDLSTNSLDGDIPISLGGCPKLHAMNLSMNHLSVSATT

ILPVIFPKSLSNVKRNFIHGQDLSWMGNLTSLRDFILEGNIFTGNIPETFGKILNLTYFSVQNNQLEGHVPLSIF

NISSIRILDLGFNRLSGSHPLDIGIKLPRISRFNTINNRFEGIIPPTLSNASALEVLLLHGNNYHGIIPREIGIH

GNLKVFVLGYNALQATRSSDWEFMTSLTNCSSLTRLDVAHKNLVGEMPINIANLSKELIGIYLSENQITGTIPED

LWKLNKLTSLNLSCNLFTGTLPPDIGRLPIINSIFMSHNRITGQIPQPLGNISQLIFLSLSNNLLDGSIPISLGN

LTKLNLLDLSSNALMGQIPQEILTIPSLTLLLSLSNNALSGSIPTQIGHLNNLIKMDLSMNKLSGEIPKAIGSCV

QLSFLNFYRNLLQGQIPESLNNLRSLETLDLSNNNLAGPVPLFLANFTLLTNLNLSFNKLSGPVPNIGIFCNATI

VSISVHRLHVLIFCIAGTLIFSLFCMTAYCFIKTRMKPNIVDNENPFLYETNERISYAELQAATESFSPANLIGS

GSFGNVYIGNLIIDQNLVPVAIKVLNLDQRGASRSFLSECDALRRIRHRKLVKVITVCSGLDQNGDEFKALVLEF

ICNGSLDEWLHATSTTTSTSYRKLNMVERLHIAVDVAEALEYLHHHIVPPIVHCDIKPGNILLDDDMVAHVTDFG

LAKIMHSEPRIQSSSLVIKGTIGYVPPEYGAGSQVSMDGDIYSYGVLLLEIFTGRRPTDNFINGITSLVDYVKMA

YPNNLLEILDASATYNGNTQELVELVIYPIFRLGLGCCKESPRERMKMDDVVKELIAIKKACTAMPK

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	85	108	4.8
LRR [Pfam ls]	109	132	0.14
LRR [Pfam ls]	357	380	0.49
LRR [Pfam ls]	381	404	0.0019
LRR [Pfam ls]	429	452	0.68
LRR [Pfam ls]	453	477	6.4
LRR [Pfam ls]	526	549	0.59
LRR [Pfam ls]	550	573	0.009
Ser/Thr pkinase [Pfam fs]	667	899	1.1e-42
Ser/Thr pkinase [Pfam ls]	667	957	1.5e-40

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	85	108	0.18
LRR [sensitive, ls]	85	108	4.8
LRR [sensitive, ls]	109	132	0.0055
LRR [sensitive, ls]	109	132	0.14
LRR [sensitive, ls]	181	204	0.76
LRR [sensitive, ls]	181	204	20
LRR [sensitive, ls]	205	228	0.51
LRR [sensitive, ls]	205	228	13
LRR [sensitive, ls]	229	259	0.52
LRR [sensitive, ls]	229	259	14
LRR [sensitive, ls]	302	325	1.9
LRR [sensitive, ls]	302	325	49
LRR [sensitive, ls]	357	380	0.018
LRR [sensitive, ls]	357	380	0.49
LRR [sensitive, ls]	381	404	7.3e-05
LRR [sensitive, ls]	381	404	0.0019
LRR [sensitive, ls]	405	428	2.6
LRR [sensitive, ls]	405	428	69
LRR [sensitive, ls]	429	452	0.026
LRR [sensitive, ls]	429	452	0.68
LRR [sensitive, ls]	453	477	0.24
LRR [sensitive, ls]	453	477	6.4
LRR [sensitive, ls]	478	501	0.7
LRR [sensitive, ls]	478	501	19
LRR [sensitive, ls]	502	525	0.9
LRR [sensitive, ls]	502	525	24
LRR [sensitive, ls]	526	549	0.022
LRR [sensitive, ls]	526	549	0.59
LRR [sensitive, ls]	550	573	0.00034
LRR [sensitive, ls]	550	573	0.009
LRR [sensitive, ls]	574	599	0.37
LRR [sensitive, ls]	574	599	9.8

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	9	780	1e-146
FLS2 [A.thaliana]	10	644	2e-71
Cf-9 [L. pimpinellifolium]	11	590	3e-45
CLV2 [A. thaliana]	29	592	1e-50
CLV2 [A. thaliana]	45	616	5e-30
Cf-9 [L. pimpinellifolium]	89	590	4e-47
FLS2 [A.thaliana]	89	959	1e-109
Cf-9 [L. pimpinellifolium]	108	543	3e-35
Pto [L. esculentum]	639	955	2e-26
Rpg1 [Hordeum vulgare]	646	880	2e-17
Rpg1 [Hordeum vulgare]	648	955	6e-30

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	7	29	in -> out
putative TM domain	610	632	out -> in

Report for 4356.m00190

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)