Report for 4356.m00193

 > 4356.m00193, length: 490, copies: 2 

MAIKWQLWMLSLIKHALLLLTATSQTINGDDLSALLSFKSLIRNDPRQVLSSWDSIGNDTNMPAHVFCRWTGVSC

NNCRHPGRVTTLRLSGAGLVGTISPQLGNLTLLRVLDLSANSLDGDIPASLGSCRKLHTLNLSRNHLLGSMPADL

GQSSKLAIFDAGYNNLTGNVPKSLSNLTTLMKFIIKRNIIHGKNLSWMGNLTSLTHFVLDGNRFTGNISESFGKM

ANLIYFNVRDNQLEGHVPLPIFNISCIRFLDLGFNRLSGSIPLDIGFKLPRINYFSTIANHFEGIIPPTFSNTSA

IESLLLRGNKYHDTIPREIGIHGNLKFFALGDNMLQATRPSDWEFFTSLANCSSLQMLDVGQNNLAGAMPISIAN

LSKELNWIDLGGNQIIGTIHTDLWKLKLIFLNLSYNLLTGTLPPDIGRLPSINYIYISHNRITGQIPESLGNISQ

LSSLDLSNNLLYGSVPVSLGNLTELQKLDLSVNALTGQIP

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	83	106	2.7
LRR [Pfam ls]	107	130	1.2
LRR [Pfam ls]	131	154	1.2
LRR [Pfam ls]	203	226	4.1
LRR [Pfam ls]	251	275	0.17
LRR [Pfam ls]	402	425	0.0063
LRR [Pfam ls]	426	449	0.39
LRR [Pfam ls]	450	473	0.14

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	83	106	0.1
LRR [sensitive, ls]	83	106	2.7
LRR [sensitive, ls]	107	130	0.044
LRR [sensitive, ls]	107	130	1.2
LRR [sensitive, ls]	131	154	0.046
LRR [sensitive, ls]	131	154	1.2
LRR [sensitive, ls]	155	178	0.26
LRR [sensitive, ls]	155	178	6.9
LRR [sensitive, ls]	203	226	0.15
LRR [sensitive, ls]	203	226	4.1
LRR [sensitive, ls]	227	250	2.3
LRR [sensitive, ls]	227	250	61
LRR [sensitive, ls]	251	275	0.0065
LRR [sensitive, ls]	251	275	0.17
LRR [sensitive, ls]	324	347	2.4
LRR [sensitive, ls]	324	347	65
LRR [sensitive, ls]	354	377	0.39
LRR [sensitive, ls]	354	377	10
LRR [sensitive, ls]	379	400	1.8
LRR [sensitive, ls]	379	400	47
LRR [sensitive, ls]	402	425	0.00024
LRR [sensitive, ls]	402	425	0.0063
LRR [sensitive, ls]	426	449	0.015
LRR [sensitive, ls]	426	449	0.39
LRR [sensitive, ls]	450	473	0.0051
LRR [sensitive, ls]	450	473	0.14

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	3	490	2e-77
FLS2 [A.thaliana]	17	483	8e-36
CLV2 [A. thaliana]	27	489	3e-38
FLS2 [A.thaliana]	31	490	3e-58
Cf-9 [L. pimpinellifolium]	68	490	7e-20
Cf-9 [L. pimpinellifolium]	76	394	1e-18
CLV2 [A. thaliana]	84	487	1e-29
CLV2 [A. thaliana]	84	490	4e-27
FLS2 [A.thaliana]	84	490	9e-48
Xa21 [O. sativa]	84	490	1e-47
Cf-9 [L. pimpinellifolium]	87	308	1e-15
FLS2 [A.thaliana]	90	490	2e-53
Xa21 [O. sativa]	102	443	6e-27
Cf-9 [L. pimpinellifolium]	106	490	3e-38

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 4356.m00193

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)