Report for 4493.m00098

 > 4493.m00098, length: 891, copies: 2 

MRQTRSLAAAAAVLVVGVVLHWVGVVDAATAAERGILLEFKAAVTDPNGALASWTAGGDPCVDFAGVTCDPSSRA

VQRLRVHGAGIAGKLTPSLARLASLESVSLFGNGLSGGIPSSFSALGPTLHKLNLSRNALSGEIPPFLGAFPWLR

LLDLSYNAFSGEIPASLFDPCLRLRYVSLAHNALTGPVPTAITNCSRLAGFDFSYNRLSGELPDQLCAPPEISYI

SVRSNSLSGAIAGKLNACRSIDLLDVGSNHFAGPAPFGLLGLVNITYFNVSSNAFDGEIPNIATCGTKFSYFDAS

GNRLTGPVPESVANCRSLRVLDLGTNALAGDIPPSIGKLRSLSVLRLAGNAGIAGSIPAELGGIEMLVTLDLAGL

ALIGDIPVSLSQCQFLLELNLSGNQLQGVIPDTLNNLTYLKLLDLHRNHLVGGIPVTLAQLTNLDLLDLSENQLT

GPIPSELGNLSNLTHFNVSYNGLSGMIPALPVLQSFGSSAFMGNPLLCGPPLNNLCGASRRAKQLAVSVIIVIVA

AALILIGVCIVCAMNIKAYMRRSKEEQEGKEEDEVLESESTPMLASPGRQGSNAIIGKLVLFSKSLPSRYEDWEA

GTKALLDKDCLVGGGSVGTVYKATFENGLSIAVKKLETLGRVRSQDEFEQEMGQLGNLSHPNLVAFQGYYWSSST

QLILSEFMVNGSLYDHLHGSPHTFSGSSSRVGLSWEQRFKVALGTARALAYLHHDCRPQVLHLNIKSSNIMLDKD

FEAKLSDYGFGKLLPILGSYELSRLHAAIGYIAPELASPSLRYSDKSDVFSFGVVLLEIVTGRKPVESPGVATAV

VLRDYVRAILEDGTVSDCFDRSMKGFVEAELVQVLKLGLVCTSNTPSARPNMAEVVQYLESVRTNS

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	99	122	0.32
LRR [Pfam ls]	124	147	0.039
LRR [Pfam ls]	173	196	0.85
LRR [Pfam ls]	317	340	0.26
LRR [Pfam ls]	390	413	0.0035
LRR [Pfam ls]	414	437	0.66
LRR [Pfam ls]	438	461	0.019
LRR [Pfam ls]	462	484	0.48
Ser/Thr pkinase [Pfam fs]	606	815	9.9e-37
Ser/Thr pkinase [Pfam ls]	606	884	1.1e-31

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	99	122	0.01
LRR [sensitive, ls]	99	122	0.32
LRR [sensitive, ls]	124	147	0.0012
LRR [sensitive, ls]	124	147	0.039
LRR [sensitive, ls]	148	172	0.34
LRR [sensitive, ls]	148	172	11
LRR [sensitive, ls]	173	196	0.027
LRR [sensitive, ls]	173	196	0.85
LRR [sensitive, ls]	197	220	0.88
LRR [sensitive, ls]	197	220	28
LRR [sensitive, ls]	245	266	0.89
LRR [sensitive, ls]	245	266	28
LRR [sensitive, ls]	269	291	1.1
LRR [sensitive, ls]	269	291	35
LRR [sensitive, ls]	293	316	0.46
LRR [sensitive, ls]	293	316	14
LRR [sensitive, ls]	317	340	0.0082
LRR [sensitive, ls]	317	340	0.26
LRR [sensitive, ls]	341	365	0.43
LRR [sensitive, ls]	341	365	13
LRR [sensitive, ls]	366	389	2.3
LRR [sensitive, ls]	366	389	72
LRR [sensitive, ls]	390	413	0.00011
LRR [sensitive, ls]	390	413	0.0035
LRR [sensitive, ls]	414	437	0.021
LRR [sensitive, ls]	414	437	0.66
LRR [sensitive, ls]	438	461	0.00061
LRR [sensitive, ls]	438	461	0.019
LRR [sensitive, ls]	462	484	0.015
LRR [sensitive, ls]	462	484	0.48

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	14	478	2e-53
Xa21 [O. sativa]	31	478	7e-52
CLV2 [A. thaliana]	33	479	2e-57
Cf-9 [L. pimpinellifolium]	61	477	3e-25
Cf-9 [L. pimpinellifolium]	72	469	2e-30
FLS2 [A.thaliana]	78	478	2e-48
Xa21 [O. sativa]	79	261	7e-12
FLS2 [A.thaliana]	86	888	3e-92
FLS2 [A.thaliana]	86	494	9e-53
Xa21 [O. sativa]	86	693	3e-48
CLV2 [A. thaliana]	87	498	6e-41
Cf-9 [L. pimpinellifolium]	94	497	5e-30
Cf-9 [L. pimpinellifolium]	100	507	3e-45
FLS2 [A.thaliana]	100	479	3e-42
Cf-9 [L. pimpinellifolium]	149	479	6e-17
Xa21 [O. sativa]	321	484	1e-21
Xa21 [O. sativa]	367	508	5e-16
Rpg1 [Hordeum vulgare]	595	887	1e-23
Pto [L. esculentum]	596	885	2e-34
Rpg1 [Hordeum vulgare]	615	887	1e-21

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	7	29	in -> out
putative TM domain	515	537	out -> in

Report for 4493.m00098

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)