Report for 4538.m00153

 > 4538.m00153, length: 1023, copies: 1 

MAGTDMEALLEFGRGIRQDSSGHRATPWNPTSALDSDGCPLDWHGVQCSNGQILSIAFDGAGLVGNVSLSALASM

PMLQNLSLSNNKLVGVLPRDLGSMTSLQLLDLSNNMFSGQIPAELTKLANLGHLNLSSNGFGGALPLGLRNLRKL

KYLDLRGNGFTGKLDDIFAELQSPVHVDLSCNRFSGSLISISDNSSVVSTLQYLNVSHNMLSGALFESDPMPLFD

SLEVFDASYNMLEGNIPPFNFVISLKVLRLQNNNFSGSIPEALFRQTSMVLTELDLSCNQLTGPIRRVTSMNLKY

LNLSSNSLQGTLPITFGSCSVVDLSRNMLSGNLSVIRTWGNYIETVDLTSNRLTGTWPNETTQFLRLTSLRISDN

LLAGELPTVIGTYPELISIDLSLNQLHGPLPGNLFTAVKLTYLNLSGNSFAGTLPLPNSEAKSSTFIDLLVLPVQ

TSNLSFVDLSNNSLNGSLPSGIGALSGLALLNLCQNNFSGQIPREITKLKHLIYIDLSKNNFNGTIPEDLPDDLV

EFNVSYNNLSGSVPSNLLKFPDSSFHPGNELLVLPHSASQNGPDSSGGGRRGMKRGILYALIVCVVVFVTGIIVL

LLVHWKISSWKSSEKGTSQSKQPATVGECSQRQGEAPTPEMQEVSLESSSSTEYVGNPLPGKERQHEAQDVSVHA

DQIGSSSTLKDNMASLMPPLTSSPPDVRAQHQHSVLRVHSPDKMVGDLHLFDNLVVFTAEELSRAPAEIIGRSCH

GTSYKATLDNGYALTVKWLKEGFAKSKKEFSREIKKLGTVKHPNLVSMRGYYWGPKEHERIIISDYVDSTSLSSF

LSEFEERNIPPLSVDQRLNIAIDIAHCLDYLHNERVIPHGNLKSSNVLIQNASPSALVTDYSLHRLMTPIGMAEQ

VLNAGALGYSPPEFASSSKPCPSLKSDVYAFGVILLELLTGKIAGEIVCVNDGVVDLTDWVRMLAREERVSECYD

RRIVEAHGSGGAPKALEDMLRIAIRCIRSASERPEIRTVFEDLSSLSS

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	77	100	0.4
LRR [Pfam ls]	101	124	0.02
LRR [Pfam ls]	125	148	1
LRR [Pfam ls]	149	172	0.085
LRR [Pfam ls]	249	273	0.017
LRR [Pfam ls]	297	320	0.012
LRR [Pfam ls]	414	434	7.1
LRR [Pfam ls]	453	476	0.25
LRR [Pfam ls]	477	500	6.8
LRR [Pfam ls]	501	521	1.8
LRR [Pfam ls]	523	546	5.8
Ser/Thr pkinase [Pfam ls]	739	1015	1.1e-10
Ser/Thr pkinase [Pfam fs]	766	874	1.2e-10
Ser/Thr pkinase [Pfam fs]	923	941	0.00097

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	77	100	0.013
LRR [sensitive, ls]	77	100	0.4
LRR [sensitive, ls]	101	124	0.00063
LRR [sensitive, ls]	101	124	0.02
LRR [sensitive, ls]	125	148	0.032
LRR [sensitive, ls]	125	148	1
LRR [sensitive, ls]	149	172	0.0027
LRR [sensitive, ls]	149	172	0.085
LRR [sensitive, ls]	173	195	1.1
LRR [sensitive, ls]	173	195	35
LRR [sensitive, ls]	200	222	0.38
LRR [sensitive, ls]	200	222	12
LRR [sensitive, ls]	226	248	0.56
LRR [sensitive, ls]	226	248	17
LRR [sensitive, ls]	249	273	0.00053
LRR [sensitive, ls]	249	273	0.017
LRR [sensitive, ls]	275	294	0.41
LRR [sensitive, ls]	275	294	13
LRR [sensitive, ls]	297	320	0.00038
LRR [sensitive, ls]	297	320	0.012
LRR [sensitive, ls]	366	389	0.39
LRR [sensitive, ls]	366	389	12
LRR [sensitive, ls]	414	434	0.23
LRR [sensitive, ls]	414	434	7.1
LRR [sensitive, ls]	453	476	0.0081
LRR [sensitive, ls]	453	476	0.25
LRR [sensitive, ls]	477	500	0.22
LRR [sensitive, ls]	477	500	6.8
LRR [sensitive, ls]	501	521	0.056
LRR [sensitive, ls]	501	521	1.8
LRR [sensitive, ls]	523	546	0.18
LRR [sensitive, ls]	523	546	5.8

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	2	615	6e-48
FLS2 [A.thaliana]	5	542	4e-48
Cf-9 [L. pimpinellifolium]	24	543	5e-35
CLV2 [A. thaliana]	42	543	1e-43
Cf-9 [L. pimpinellifolium]	48	313	1e-16
FLS2 [A.thaliana]	48	399	4e-33
FLS2 [A.thaliana]	52	678	2e-46
CLV2 [A. thaliana]	72	331	6e-23
Cf-9 [L. pimpinellifolium]	74	569	4e-44
FLS2 [A.thaliana]	78	541	8e-49
Cf-9 [L. pimpinellifolium]	153	562	1e-23
FLS2 [A.thaliana]	714	1021	3e-19
Rpg1 [Hordeum vulgare]	720	1021	5e-18
Rpg1 [Hordeum vulgare]	742	1021	1e-10
Pto [L. esculentum]	745	1014	4e-22

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	581	603	out -> in

Report for 4538.m00153

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)