Report for 4581.m00119

 > 4581.m00119, length: 1030, copies: 1 

MTSARHLFFTLSFSFLALLSCIAVCNAGDEAAALLAIKASLVDPLGELKGWSSAPHCTWKGVRCDARGAVTGLNL

AAMNLSGAIPDDILGLAGLTSIVLQSNAFDGELPPVLVSIPTLRELDVSDNNFKGRFPAGLGACASLTHLNASGN

NFAGPLPADIGNATALETLDFRGGFFSGGIPKTYGKLQKLKFLGLSGNNLNGALPAELFELSSLEQLIIGYNEFS

GAIPAAIGNLAKLQYLDMAIGSLEGPIPPELGRLPYLNTVYLYKNNIGGQIPKELGNLSSLIMLDLSDNAITGTI

PPELAQLTNLQLLNLMCNKIKGGIPAGIGELPKLEVLELWNNSLTGPLPPSLGKAQPLQWLDVSTNALSGPVPAG

LCDSGNLTKLILFNNVFTGAIPAGLTTCSTLVRVRAHNNRLNGTVPLGLGRLPRLQRLELAGNELSGEIPDDLAL

STSLSFIDLSHNQLRSALPSNILSIPALQTFAAADNELTGGVPDELADCPSLSALDLSNNRLSGAIPASLASCQR

LVSLSLRNNRFTGQIPAAVAMMPTLSVLDLSNNFFSGEIPSNFGSSPALEMLNLAYNNLTGPVPATGLLRTINPD

DLAGNPGLCGGVLPPCGASSLRSSSSESYDLRRSHMKHIAAGWAIGISAVIAACGAMFLGKQLYHRWYVHGGCCD

DAAVEEEGSGSWPWRLTAFQRLSFTSAEVLACIKEANIVGMGGTGVVYRADMPRHHAVVAVKKLWRAAGCPEEAT

TVDGRTDVEAGGEFAAEVKLLGRLRHRNVVRMLGYVSNNLDTMVIYEYMVNGSLWDALHGQRKGKMLMDWVSRYN

VAAGVAAGLAYLHHDCRPPVIHRDVKSSNVLLDDNMDAKIADFGLARVMARAHETVSVVAGSYGYIAPEYGYTLK

VDQKSDIYSFGVVLMELLTGRRPIEPEYGESQDIVGWIRERLRSNTGVEELLDASVGGRVDHVREEMLLVLRVAV

LCTAKSPKDRPTMRDVVTMLGEAKPRRKSSSATVAATVVDKDKPVFTTSPDSGYL

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	117	140	0.87
LRR [Pfam ls]	141	164	3.6
LRR [Pfam ls]	189	212	0.68
LRR [Pfam ls]	213	236	5.4
LRR [Pfam ls]	261	284	5
LRR [Pfam ls]	285	308	0.0034
LRR [Pfam ls]	309	332	0.28
LRR [Pfam ls]	333	356	1.2
LRR [Pfam ls]	381	401	3.7
LRR [Pfam ls]	429	452	0.1
LRR [Pfam ls]	453	476	5.4
LRR [Pfam ls]	501	524	0.2
LRR [Pfam ls]	525	548	4
LRR [Pfam ls]	549	572	0.034
LRR [Pfam ls]	573	595	5.7
Ser/Thr pkinase [Pfam fs]	708	923	4.7e-45
Ser/Thr pkinase [Pfam ls]	708	995	1.4e-42

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	93	116	1.4
LRR [sensitive, ls]	93	116	45
LRR [sensitive, ls]	117	140	0.028
LRR [sensitive, ls]	117	140	0.87
LRR [sensitive, ls]	141	164	0.11
LRR [sensitive, ls]	141	164	3.6
LRR [sensitive, ls]	165	188	2.3
LRR [sensitive, ls]	165	188	72
LRR [sensitive, ls]	189	212	0.022
LRR [sensitive, ls]	189	212	0.68
LRR [sensitive, ls]	213	236	0.17
LRR [sensitive, ls]	213	236	5.4
LRR [sensitive, ls]	237	260	0.77
LRR [sensitive, ls]	237	260	24
LRR [sensitive, ls]	261	284	0.16
LRR [sensitive, ls]	261	284	5
LRR [sensitive, ls]	285	308	0.00011
LRR [sensitive, ls]	285	308	0.0034
LRR [sensitive, ls]	309	332	0.009
LRR [sensitive, ls]	309	332	0.28
LRR [sensitive, ls]	333	356	0.037
LRR [sensitive, ls]	333	356	1.2
LRR [sensitive, ls]	357	380	3.7
LRR [sensitive, ls]	357	380	120
LRR [sensitive, ls]	381	401	0.12
LRR [sensitive, ls]	381	401	3.7
LRR [sensitive, ls]	405	428	0.72
LRR [sensitive, ls]	405	428	23
LRR [sensitive, ls]	429	452	0.0032
LRR [sensitive, ls]	429	452	0.1
LRR [sensitive, ls]	453	476	0.17
LRR [sensitive, ls]	453	476	5.4
LRR [sensitive, ls]	477	500	2.5
LRR [sensitive, ls]	477	500	79
LRR [sensitive, ls]	501	524	0.0064
LRR [sensitive, ls]	501	524	0.2
LRR [sensitive, ls]	525	548	0.13
LRR [sensitive, ls]	525	548	4
LRR [sensitive, ls]	549	572	0.0011
LRR [sensitive, ls]	549	572	0.034
LRR [sensitive, ls]	573	595	0.18
LRR [sensitive, ls]	573	595	5.7

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	1	623	5e-89
Xa21 [O. sativa]	1	809	5e-92
CLV2 [A. thaliana]	30	629	3e-71
Cf-9 [L. pimpinellifolium]	57	592	4e-52
Cf-9 [L. pimpinellifolium]	70	375	3e-25
FLS2 [A.thaliana]	70	1004	1e-117
Cf-9 [L. pimpinellifolium]	73	627	4e-58
Cf-9 [L. pimpinellifolium]	241	661	3e-26
Rpg1 [Hordeum vulgare]	710	1013	1e-29
Rpg1 [Hordeum vulgare]	710	992	2e-18
Pto [L. esculentum]	714	995	2e-36

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	7	29	in -> out

Report for 4581.m00119

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)