Report for 4621.m00161

 > 4621.m00161, length: 1063, copies: 1 

MAKAPGPVYLLFLLLALPCCLIPHRGAAQPAANEARLLLQIKRAWGDPAVLAGWNDTAAPAAHCSWPYVTCDTAG

RVTNLSLANTNVSGPVSDAVGGLSSLVHLDLYNNNINGTFPTSVYRCVSLRYLNLSQNYLGGELPADIGVGLGEN

LTTLVLSGNYFTGTIPKSLSRLQKLEWLMLDNNNLTGTIPGELGDLTSLTTLTISTNKLGPGQLPESFKNLTKLT

TLWARKCQLVGDMPAYVADMPDLVTLDLAVNNLTGSIPPGIWSLKKLQCLFLFANKLTGDIVVADGAFAAVNLVF

IDLSANPKLGGPIPQDFGLLQKLEVIHLYFNNFSGEIPASIGRLPALKEIHLFNNSLTGVLPPELGQKSPDLWDL

EVDFNKFTGPIPEGLCDGGKLNIFTAANNLLNGSIPERLAGCTTLQTLFLPNNKLSGDVPEALWTATKLQFVQLQ

NNGLTGTLPSTMYSNLSSLTVENNQFRGSIPAAAAALQKFIAGNNNFSGEIPESLGNGMPVLQTLNLSGNQLSGG

IPKSVSKLKVLTQLDLSKNQLSGEIPAELGAMPVLNALDLSSNRLSGGIPSSLASLNLNSLNLSSNQLSGQVPAK

FAIGAYARSFLDNPTLCTSGLGSSYLAGVRSCNAGSPGSASSGGVSPGLRAGLLVAGAALLLVIVALAFFAVRDI

RRRRKRVAQREDWKITPFQTDLGFSEAAILRGLTEENLVGRGGSGSVYRVAYTNRYTGGDGAVAVKKIRTGAAKV

EEKLEREFESEARILGNVRHNNIVRLLCCVSGDEAKLLVYDYMDNGSLDGWLHGRRAINDGRPVVAAVARARSAR

GGAPALDWPTRLRVAVGAAQGLYYMHHECTPPIVHRDVKTSNILLDSEFRAKVADFGLARMLAQAGTPDTVSAVA

GSFGYMAPECGYTRKVDEKVDVYSFGVVLLELTTGKAANDGGEHGSLADWARHHYQSGESIPDATDQCIRYAGYS

DEIEVVFRLGVMCTGATPASRPTMKDVLQILVKCSEQTHQKCKAESGQEEYEVAPLLLPQRGSRRKQPAKAKGAD

DDADERSDFDSIV

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	76	99	8.9
LRR [Pfam ls]	100	123	3.4
LRR [Pfam ls]	124	148	0.12
LRR [Pfam ls]	150	173	0.03
LRR [Pfam ls]	174	197	0.0089
LRR [Pfam ls]	198	222	0.21
LRR [Pfam ls]	247	270	0.46
LRR [Pfam ls]	297	321	2.5
LRR [Pfam ls]	322	345	0.077
LRR [Pfam ls]	346	370	0.78
LRR [Pfam ls]	419	442	5.2
LRR [Pfam ls]	443	467	0.29
LRR [Pfam ls]	511	534	0.021
LRR [Pfam ls]	535	558	0.14
LRR [Pfam ls]	582	602	5.8
Ser/Thr pkinase [Pfam fs]	708	942	4.3e-49
Ser/Thr pkinase [Pfam ls]	708	1008	9.8e-45

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	76	99	0.45
LRR [sensitive, ls]	76	99	8.9
LRR [sensitive, ls]	100	123	0.17
LRR [sensitive, ls]	100	123	3.4
LRR [sensitive, ls]	124	148	0.0061
LRR [sensitive, ls]	124	148	0.12
LRR [sensitive, ls]	150	173	0.0015
LRR [sensitive, ls]	150	173	0.03
LRR [sensitive, ls]	174	197	0.00045
LRR [sensitive, ls]	174	197	0.0089
LRR [sensitive, ls]	198	222	0.011
LRR [sensitive, ls]	198	222	0.21
LRR [sensitive, ls]	223	246	5
LRR [sensitive, ls]	223	246	99
LRR [sensitive, ls]	247	270	0.023
LRR [sensitive, ls]	247	270	0.46
LRR [sensitive, ls]	297	321	0.13
LRR [sensitive, ls]	297	321	2.5
LRR [sensitive, ls]	322	345	0.0039
LRR [sensitive, ls]	322	345	0.077
LRR [sensitive, ls]	346	370	0.04
LRR [sensitive, ls]	346	370	0.78
LRR [sensitive, ls]	371	391	7.5
LRR [sensitive, ls]	371	391	150
LRR [sensitive, ls]	395	418	3.2
LRR [sensitive, ls]	395	418	64
LRR [sensitive, ls]	419	442	0.26
LRR [sensitive, ls]	419	442	5.2
LRR [sensitive, ls]	443	467	0.015
LRR [sensitive, ls]	443	467	0.29
LRR [sensitive, ls]	486	510	0.96
LRR [sensitive, ls]	486	510	19
LRR [sensitive, ls]	511	534	0.0011
LRR [sensitive, ls]	511	534	0.021
LRR [sensitive, ls]	535	558	0.0069
LRR [sensitive, ls]	535	558	0.14
LRR [sensitive, ls]	559	579	0.56
LRR [sensitive, ls]	559	579	11
LRR [sensitive, ls]	582	602	0.3
LRR [sensitive, ls]	582	602	5.8

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	10	803	1e-79
FLS2 [A.thaliana]	12	600	1e-79
Cf-9 [L. pimpinellifolium]	54	615	1e-46
CLV2 [A. thaliana]	65	623	5e-57
Cf-9 [L. pimpinellifolium]	76	598	2e-50
FLS2 [A.thaliana]	79	1008	1e-107
Cf-9 [L. pimpinellifolium]	80	412	4e-24
Cf-9 [L. pimpinellifolium]	80	265	3e-14
Rpg1 [Hordeum vulgare]	693	1008	2e-14
Rpg1 [Hordeum vulgare]	709	1006	4e-24
Pto [L. esculentum]	714	1003	4e-29

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	650	672	out -> in

Report for 4621.m00161

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)