Report for 4655.m00160

 > 4655.m00160, length: 586, copies: 2 

MSAPGAGAAAGAAAASGDDAPGAGAVANVNTNRGNSASQFSGGPFSGLKKLNLDAIGLHGLFPNVLGDMVSLQVL

VLSSNEMTMKTTNLTTLCNLRVLQLRESYSYGNISELIESLPLCAFGKLQELYLQGNHFTGTLPNWLGQLTSLVI

LDLSMNNITGPLPGIFGKFTDLRDLNLAGNQLTGHLPSQISMLSNLTRLDLSNNILDGLITDEHFVGLKGLEYID

LSHNRLKIVLGSPPFRLKKHILQTARWVLCFLHGFSGRWIFLTLILQAQISGGLPTNWEIMSVEQLYLSSNQFTG

EIPSLPRNIITLDISSNSLTDLANNHFEGDLPECAEMENLDILMLSNNSFSGKFPSFLQRCFFLSFLDLAWNEFS

GTLPMWIGNCTSLRFLRLNNNMFHGHIPGSITGLRDLRHLNLAENRLSGPIPSGGQLETLYTYNPLMYSGNNGLC

GFPLQRSCPGNSTSKDGDLSNEKHGDQQIPELHSDDQMFFLFGCGVGFVVGSWVVFFSLLFVKTWRIAYFRLFDS

VYDKIVAYNAIFQLIWNLEELCLSSSRVANTLATGEVISMKYSIVTLVLRLQESGKRRFYF

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	123	146	0.0029
LRR [Pfam ls]	147	170	0.23
LRR [Pfam ls]	171	194	0.56
LRR [Pfam ls]	195	219	0.3
LRR [Pfam ls]	220	243	5.3
LRR [Pfam ls]	308	331	2.1
LRR [Pfam ls]	339	362	4.7
LRR [Pfam ls]	387	410	0.27
LRR [Pfam ls]	411	433	2.4

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	47	70	6.4
LRR [sensitive, ls]	47	70	70
LRR [sensitive, ls]	71	96	1.2
LRR [sensitive, ls]	71	96	13
LRR [sensitive, ls]	123	146	0.00027
LRR [sensitive, ls]	123	146	0.0029
LRR [sensitive, ls]	147	170	0.021
LRR [sensitive, ls]	147	170	0.23
LRR [sensitive, ls]	171	194	0.051
LRR [sensitive, ls]	171	194	0.56
LRR [sensitive, ls]	195	219	0.027
LRR [sensitive, ls]	195	219	0.3
LRR [sensitive, ls]	220	243	0.49
LRR [sensitive, ls]	220	243	5.3
LRR [sensitive, ls]	287	307	0.61
LRR [sensitive, ls]	287	307	6.6
LRR [sensitive, ls]	308	331	0.19
LRR [sensitive, ls]	308	331	2.1
LRR [sensitive, ls]	339	362	0.43
LRR [sensitive, ls]	339	362	4.7
LRR [sensitive, ls]	363	386	1.4
LRR [sensitive, ls]	363	386	15
LRR [sensitive, ls]	387	410	0.025
LRR [sensitive, ls]	387	410	0.27
LRR [sensitive, ls]	411	433	0.22
LRR [sensitive, ls]	411	433	2.4
LRR [sensitive, ls]	542	566	5.7
LRR [sensitive, ls]	542	566	62

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	14	428	4e-30
CLV2 [A. thaliana]	24	428	2e-30
CLV2 [A. thaliana]	26	447	3e-24
Cf-9 [L. pimpinellifolium]	30	531	9e-29
CLV2 [A. thaliana]	36	450	7e-19
Xa21 [O. sativa]	38	403	4e-23
Cf-9 [L. pimpinellifolium]	43	427	1e-21
FLS2 [A.thaliana]	43	451	3e-37
FLS2 [A.thaliana]	43	433	2e-36
Cf-9 [L. pimpinellifolium]	46	435	3e-28
FLS2 [A.thaliana]	48	441	5e-32
FLS2 [A.thaliana]	58	429	5e-33
Xa21 [O. sativa]	59	451	5e-26
FLS2 [A.thaliana]	122	453	4e-24
Cf-9 [L. pimpinellifolium]	142	428	3e-17
Xa21 [O. sativa]	280	438	1e-10
Xa21 [O. sativa]	306	454	1e-14

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	489	511	out -> in

Report for 4655.m00160

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)