Report for 4655.m00163

 > 4655.m00163, length: 1351, copies: 1 

MCTFIVVLTSIVFLMVTSNGQAQAPIGCIPRERDALLEFKNSITDDPMGQLKFWRRGDDCCQWRGIRCSNRTGHV

IKLQLWKPKFDDDGMSLVGNGMVGLISPSLLSLEHLQHLDLSWNNLSGSDGHIPGFIGSFRNLRYLNLSGMPFIG

VVPPQLGNLSKLQFLDLSSCIGLEMQSRSGMTWLRNIPLLQYLNLNSVDLSAVDNWLHVMNQLPSLRVLNLSNCS

LQRADQKLTHLHNNFTRLERLDLSGNQFNHPAASCWFWNITSLKDLILSGNRLYGQLPDALADMTSLQVLDFSIN

RPVPISPIGLLPSSQAPPSSGDDDAAIEGITIMAENLRNLCSLEILDLTQSLSSGNITELIDNLAKCPASKLQQL

ILKYNNITGILPISMGVFSSLVYLDLSQNYLTGQLPSEIGMLRNLTWMDLSYNGLVHLPPEIGMLTNLAYIDLGH

NNFSHLPSEIGMLSNLGYLDLSFNNLDGVITEKHFAHLASLESIYLPYNSLEIVVDPEWLPPFRLKYAYFYCCQM

GPMFPKWLQTQVDIIELDIANTSIKDTFPEWFWTTVSKATYLDISNNQIRGGLPTNMETMLLETFYLDSNLITGE

IPELPINLETLDISNNYLSGPLPSNIGAPNLAHLNLYSNQISGHIPGYLCNLGALEALDLGNNRFEGELPRCFEM

GVGSLKFLRLSNNRLSGNFPSFLRKCKELHFIDLSWNKLSGILPKWIGDLTELQILRLSHNSFSGDIPRSITKLT

NLHHLDLASNNISGAIPNSLSKILAMIGQPYEGADQTPAASGVNYTSPVATKGQERQYNEENVEVVNIDLSSNFL

TGGIPEDIVSLGGLVNLNLSRNHLSGQIPYKIGAMRMLASLDLSENKLYGEIPASLSSLTFLSYLNLSYNSLTGR

IPSGSQLETIYNQHPDIYNGNSGLCGPPLQKNCSSNNVPKQGSQPVQLLTHTHINLTKLEHLGLSRNYFGHPIAS

SWFWKVRTIKELGLSETYLHGPFPDALGGITSLQQLDFTNNDLSRNKFYGALPVWIGDLENLRFLQLSHNMFHGN

IPVNIANLGSLQYLNLAANNMSGSIPRTLVNLKAMTLHPTRIDVGWYESLTYYVLLTDILSLVMKHQELNYHAEG

SFDLVGIDLSQNQLTGGIPDQVTCLDGLVNLNLSSNHLKGKIPDNVGDMKSVESLDFSRNNLSGEIPLSLSDLTY

LSSLDLSHNKFVGRIPRGSQLDTLYANNPSMYDGNSGLCGPPLQRNCSSVNAPKHGKQNISVEDTEAVMFFHFGL

VSGLCDWSLGGVLRHIVQKIMESCLFPPSRQLIRQSSKTEDKTGDKRKGGEVSPVCSKRTRLLQFFAVAACMQER

I

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	110	136	0.023
LRR [Pfam ls]	137	160	0.22
LRR [Pfam ls]	215	237	0.13
LRR [Pfam ls]	242	264	5
LRR [Pfam ls]	267	290	0.34
LRR [Pfam ls]	371	394	5.2
LRR [Pfam ls]	395	418	0.12
LRR [Pfam ls]	419	441	0.07
LRR [Pfam ls]	442	464	0.1
LRR [Pfam ls]	465	489	0.58
LRR [Pfam ls]	563	583	4.5
LRR [Pfam ls]	607	627	3
LRR [Pfam ls]	630	653	0.029
LRR [Pfam ls]	679	702	0.065
LRR [Pfam ls]	703	726	0.1
LRR [Pfam ls]	727	750	0.042
LRR [Pfam ls]	751	774	0.18
LRR [Pfam ls]	814	837	3.8
LRR [Pfam ls]	838	861	1.5
LRR [Pfam ls]	862	885	0.87
LRR [Pfam ls]	886	908	0.39
LRR [Pfam ls]	1007	1035	4.8
LRR [Pfam ls]	1036	1059	0.14
LRR [Pfam ls]	1060	1083	0.4
LRR [Pfam ls]	1152	1175	0.23
LRR [Pfam ls]	1176	1199	0.04

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	110	136	0.0021
LRR [sensitive, ls]	110	136	0.023
LRR [sensitive, ls]	137	160	0.02
LRR [sensitive, ls]	137	160	0.22
LRR [sensitive, ls]	161	188	3.5
LRR [sensitive, ls]	161	188	38
LRR [sensitive, ls]	189	211	4.5
LRR [sensitive, ls]	189	211	49
LRR [sensitive, ls]	215	237	0.011
LRR [sensitive, ls]	215	237	0.13
LRR [sensitive, ls]	242	264	0.46
LRR [sensitive, ls]	242	264	5
LRR [sensitive, ls]	267	290	0.031
LRR [sensitive, ls]	267	290	0.34
LRR [sensitive, ls]	371	394	0.47
LRR [sensitive, ls]	371	394	5.2
LRR [sensitive, ls]	395	418	0.011
LRR [sensitive, ls]	395	418	0.12
LRR [sensitive, ls]	419	441	0.0064
LRR [sensitive, ls]	419	441	0.07
LRR [sensitive, ls]	442	464	0.0094
LRR [sensitive, ls]	442	464	0.1
LRR [sensitive, ls]	465	489	0.053
LRR [sensitive, ls]	465	489	0.58
LRR [sensitive, ls]	490	514	0.75
LRR [sensitive, ls]	490	514	8.2
LRR [sensitive, ls]	538	561	5.7
LRR [sensitive, ls]	538	561	62
LRR [sensitive, ls]	563	583	0.41
LRR [sensitive, ls]	563	583	4.5
LRR [sensitive, ls]	586	605	4.6
LRR [sensitive, ls]	586	605	51
LRR [sensitive, ls]	607	627	0.28
LRR [sensitive, ls]	607	627	3
LRR [sensitive, ls]	630	653	0.0026
LRR [sensitive, ls]	630	653	0.029
LRR [sensitive, ls]	654	676	0.64
LRR [sensitive, ls]	654	676	7
LRR [sensitive, ls]	679	702	0.006
LRR [sensitive, ls]	679	702	0.065
LRR [sensitive, ls]	703	726	0.0094
LRR [sensitive, ls]	703	726	0.1
LRR [sensitive, ls]	727	750	0.0038
LRR [sensitive, ls]	727	750	0.042
LRR [sensitive, ls]	751	774	0.016
LRR [sensitive, ls]	751	774	0.18
LRR [sensitive, ls]	814	837	0.34
LRR [sensitive, ls]	814	837	3.8
LRR [sensitive, ls]	838	861	0.14
LRR [sensitive, ls]	838	861	1.5
LRR [sensitive, ls]	862	885	0.079
LRR [sensitive, ls]	862	885	0.87
LRR [sensitive, ls]	886	908	0.036
LRR [sensitive, ls]	886	908	0.39
LRR [sensitive, ls]	958	982	0.76
LRR [sensitive, ls]	958	982	8.4
LRR [sensitive, ls]	983	1006	1.4
LRR [sensitive, ls]	983	1006	16
LRR [sensitive, ls]	1007	1035	0.44
LRR [sensitive, ls]	1007	1035	4.8
LRR [sensitive, ls]	1036	1059	0.013
LRR [sensitive, ls]	1036	1059	0.14
LRR [sensitive, ls]	1060	1083	0.037
LRR [sensitive, ls]	1060	1083	0.4
LRR [sensitive, ls]	1128	1151	0.7
LRR [sensitive, ls]	1128	1151	7.7
LRR [sensitive, ls]	1152	1175	0.021
LRR [sensitive, ls]	1152	1175	0.23
LRR [sensitive, ls]	1176	1199	0.0037
LRR [sensitive, ls]	1176	1199	0.04
LRR [sensitive, ls]	1200	1222	0.56
LRR [sensitive, ls]	1200	1222	6.1

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	3	926	3e-66
Cf-9 [L. pimpinellifolium]	4	948	2e-73
CLV2 [A. thaliana]	30	667	9e-45
Xa21 [O. sativa]	35	670	2e-39
CLV2 [A. thaliana]	306	938	5e-49
Xa21 [O. sativa]	332	949	6e-54
FLS2 [A.thaliana]	377	1240	5e-73
CLV2 [A. thaliana]	415	1075	4e-43
Cf-9 [L. pimpinellifolium]	607	1279	3e-62
CLV2 [A. thaliana]	607	1280	8e-52
FLS2 [A.thaliana]	667	1217	1e-49
Xa21 [O. sativa]	677	1260	5e-52
Cf-9 [L. pimpinellifolium]	678	1216	7e-31
Xa21 [O. sativa]	815	1216	3e-35
CLV2 [A. thaliana]	837	1216	3e-27
CLV2 [A. thaliana]	1034	1211	5e-14

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 4655.m00163

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)