Report for 4655.m00164

 > 4655.m00164, length: 695, copies: 1 

MSTAIIIVSTTTSSSFFFFLLLMITTGGGCKPRERDALLAFKEGIVKDPAGLLSSWQRGGHYDDDDDQLLEEDCC

QWRGVRCSNLTGHVVKLNLRNDYADVGTGLVGEIGHSLISLEHLRYLDLSMNNLAGPTGHVPEFLGSFRSLRYLN

LSGIVFSGMVPPQLGKLSNLKFLDFSGMLPSSMAPFLYISDASWLAHLSNLQYLNLNGVNLSTVLDWPHVLNMIP

SLKFLSLSSCSLQSANQYPTQINLRQLEILDLSNNYELSDQAESSWIWSLTSLKYLNLSSTSLYGEIPQALGNML

SLQVLDFSYNMSVSKKGNMCIMKANLKNLCNLEVLDLDYRLAYGEISEIFESLPQCSPNKLKELHLANNNLTGNL

PKLVGRLTSLVTLDLFNNNITGQVPSEIGMLTNLTNLYLHYNCLDGVITEEHFANLTSLKSIYLCYNYLEIVVDP

EWLPPFRLEKAYFASTSMGPSFPSWLQSQVDILELAMSDAGINDTFPDWFSTTFSKATFLEMSQNQIAGGLPTNM

ENMSLEKLYLDCNHIADRIPRMPRNLMLLDISYNLISGDVPQSICELQKLNGLDLSNNLLEGEFPQCSLMSRGWT

KLSFLDLSWNKFSGTLPTWIGNFNKLEFLQLKHNMFSGSIPDSITNLGKLSHLDLASNGLSGPLPQHLSNLTGMM

INHDTTNMKRDYLDVTTNLL

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	118	144	3.5
LRR [Pfam ls]	145	168	4.9
LRR [Pfam ls]	251	276	0.61
LRR [Pfam ls]	277	300	1.2
LRR [Pfam ls]	360	383	0.034
LRR [Pfam ls]	384	407	0.11
LRR [Pfam ls]	408	432	0.12
LRR [Pfam ls]	550	573	3.1
LRR [Pfam ls]	574	596	1.2
LRR [Pfam ls]	601	624	0.97
LRR [Pfam ls]	625	648	0.59
LRR [Pfam ls]	649	672	0.18

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	118	144	0.32
LRR [sensitive, ls]	118	144	3.5
LRR [sensitive, ls]	145	168	0.44
LRR [sensitive, ls]	145	168	4.9
LRR [sensitive, ls]	200	222	0.69
LRR [sensitive, ls]	200	222	7.5
LRR [sensitive, ls]	226	245	3.2
LRR [sensitive, ls]	226	245	35
LRR [sensitive, ls]	251	276	0.056
LRR [sensitive, ls]	251	276	0.61
LRR [sensitive, ls]	277	300	0.11
LRR [sensitive, ls]	277	300	1.2
LRR [sensitive, ls]	301	330	3.6
LRR [sensitive, ls]	301	330	40
LRR [sensitive, ls]	360	383	0.0031
LRR [sensitive, ls]	360	383	0.034
LRR [sensitive, ls]	384	407	0.01
LRR [sensitive, ls]	384	407	0.11
LRR [sensitive, ls]	408	432	0.011
LRR [sensitive, ls]	408	432	0.12
LRR [sensitive, ls]	433	457	0.86
LRR [sensitive, ls]	433	457	9.5
LRR [sensitive, ls]	506	526	5.1
LRR [sensitive, ls]	506	526	56
LRR [sensitive, ls]	529	548	1.4
LRR [sensitive, ls]	529	548	15
LRR [sensitive, ls]	550	573	0.28
LRR [sensitive, ls]	550	573	3.1
LRR [sensitive, ls]	574	596	0.11
LRR [sensitive, ls]	574	596	1.2
LRR [sensitive, ls]	601	624	0.088
LRR [sensitive, ls]	601	624	0.97
LRR [sensitive, ls]	625	648	0.054
LRR [sensitive, ls]	625	648	0.59
LRR [sensitive, ls]	649	672	0.016
LRR [sensitive, ls]	649	672	0.18

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	1	671	6e-50
Xa21 [O. sativa]	16	642	2e-40
CLV2 [A. thaliana]	32	649	1e-40
Cf-9 [L. pimpinellifolium]	74	676	9e-50
Cf-9 [L. pimpinellifolium]	83	641	3e-25
FLS2 [A.thaliana]	105	685	7e-50
CLV2 [A. thaliana]	122	426	5e-19
FLS2 [A.thaliana]	227	676	4e-34
FLS2 [A.thaliana]	272	676	2e-36
Xa21 [O. sativa]	274	674	1e-30
Xa21 [O. sativa]	321	674	5e-29
CLV2 [A. thaliana]	332	679	4e-25
CLV2 [A. thaliana]	347	682	2e-25
FLS2 [A.thaliana]	357	674	4e-25
Xa21 [O. sativa]	551	676	7e-15

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	5	27	in -> out

Report for 4655.m00164

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)