Report for 4695.m00159

 > 4695.m00159, length: 551, copies: 1 

MAEPGHLAQLSALTTTVITCLILITPTPAAASGASCVASERDALAAFRASLLDPAGRLATWSGHSCCRWRGVHCD

GSTGHVVKLDLRNDLTVHSDTDWILFYEVRVDIDSSWVHSALALRNTGEMISSLAALHHLRYLDLSWNNFNDSSI

PLFMADLKNLRHLDMSWVDLSAVRDWVHTVNTLSSLKVLRLRGCKLESAISTMSHFNLTRLEVLDLSVNKFNASI

QQKWLWDHKGIKELYLTEGHWFGSIPDAFGNMSALQVMDLGHNNLMGTIPTTLQHLCDLQVVSLYDNYIDGDATE

FMERLPRCSWNKLREMDLHSTNLSGELPVWIGKLSSLDFVDLSHNTLTGELPVGFGALRNMIYLNLGWNNFTGQI

SEEHFSSLLNLKYLYLSGNSFKQMVFEEDWIPPFRLKVAHLRSCRLGPKFPSWLKWQTEIRVLDVSGTCISDSLP

VWFKTVFSQAYSLNLSDNQLCGTLPRTPEDMLAMVMDLGSNNLTGQVPRFPVNITYFDLSNNSLSGPLPSDLGAP

RLEELRLYSNYITGTIPAYFCQLRRL

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	134	158	0.99
LRR [Pfam ls]	259	282	3.8
LRR [Pfam ls]	312	335	2
LRR [Pfam ls]	336	359	0.078
LRR [Pfam ls]	360	384	3.7
LRR [Pfam ls]	385	410	0.75
LRR [Pfam ls]	503	523	6.2
LRR [Pfam ls]	526	549	0.017

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	134	158	0.048
LRR [sensitive, ls]	134	158	0.99
LRR [sensitive, ls]	185	207	0.41
LRR [sensitive, ls]	185	207	8.5
LRR [sensitive, ls]	210	234	0.38
LRR [sensitive, ls]	210	234	7.9
LRR [sensitive, ls]	235	258	0.81
LRR [sensitive, ls]	235	258	17
LRR [sensitive, ls]	259	282	0.18
LRR [sensitive, ls]	259	282	3.8
LRR [sensitive, ls]	283	306	2.4
LRR [sensitive, ls]	283	306	50
LRR [sensitive, ls]	312	335	0.097
LRR [sensitive, ls]	312	335	2
LRR [sensitive, ls]	336	359	0.0038
LRR [sensitive, ls]	336	359	0.078
LRR [sensitive, ls]	360	384	0.18
LRR [sensitive, ls]	360	384	3.7
LRR [sensitive, ls]	385	410	0.037
LRR [sensitive, ls]	385	410	0.75
LRR [sensitive, ls]	434	457	0.62
LRR [sensitive, ls]	434	457	13
LRR [sensitive, ls]	459	482	1.6
LRR [sensitive, ls]	459	482	33
LRR [sensitive, ls]	503	523	0.3
LRR [sensitive, ls]	503	523	6.2
LRR [sensitive, ls]	526	549	0.00081
LRR [sensitive, ls]	526	549	0.017

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	7	551	8e-34
CLV2 [A. thaliana]	40	551	7e-29
FLS2 [A.thaliana]	40	551	3e-30
Cf-9 [L. pimpinellifolium]	57	541	7e-34
CLV2 [A. thaliana]	74	444	5e-13
FLS2 [A.thaliana]	107	377	1e-15
Cf-9 [L. pimpinellifolium]	120	388	8e-11
FLS2 [A.thaliana]	122	542	9e-32
FLS2 [A.thaliana]	122	542	1e-27
FLS2 [A.thaliana]	122	542	1e-26
CLV2 [A. thaliana]	123	541	6e-26
Cf-9 [L. pimpinellifolium]	126	542	1e-20
Cf-9 [L. pimpinellifolium]	150	545	4e-16

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 4695.m00159

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)