Report for 4727.m00138

 > 4727.m00138, length: 804, copies: 1 

MTRYKPLVLPLMLILLHTQLIIVPSSSAATYANHTGALPPAVVPCLPDQASALLRLKRSFSITKNSSSTFGSWKA

GTDCCHWEGIHCRNGDGRVTSLDLGGRRLESGVESSVLKEPNFETLIANHKKLRELYLGAVDLSDNGMTWCDALS

SSTPNLRVLSLPNCGLSGPICGSFSAMHSLAVIDLRFNDLSGPIPNFATFSSLRVLQLGHNFLQGQVSPLIFQHK

KLVTVDLYNNLELSDSLPNFSVASNLENIFVTETSFYGEIPSSIGNLKYLKNLGVGASQFSGELPSSIGWLKSLN

SLEISGTTIVGTIPSWITNLTSLTILQFSRCGLTGSIPSFLGKLTKLRKLVLYECNFSGKLPQNISNFTNLSTLF

LNSNNLVGTMKLASLWGLQHLRYLDISDNNLVVVDGKVDSSSTHIPKLQILALSGCNITKFPDFLRSQDELLWLD

LSKNQIHGAIPSWAWESWNDSGVASLILAHNKFTSVGSNPFIPLQIDWLDLSNNMFEGTIPIPQGSARLLDYSNN

MFSSIPFNFTAHLSHVTLFNAPGNNFSGEIPPSFCTATELQYLDLSNNNFSGSIPSCLIENVNGIQILNLNANQL

DGEIPDTIKEGCSFHALYFSGNRIEGQLPRSLLACQNLEILDAGNNQINDIFPCWMSKLRRLQVLVLKSNKLFGH

VVQSLTDEESTCAFPNAIIIDISSNNFSGPLPKDKWFKKLESMLHIDTNTSLVMDHAVPSVGLVYRYKASLTYKG

HDTTLAQILRTLVFIDFSNNAFNGSIPEIVGELVLTHGINMSHNFLTGPIPSQL

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	155	178	0.22
LRR [Pfam ls]	179	201	2.4
LRR [Pfam ls]	202	225	7.9
LRR [Pfam ls]	226	249	1.3
LRR [Pfam ls]	298	321	2.1
LRR [Pfam ls]	322	345	0.18
LRR [Pfam ls]	346	369	0.41
LRR [Pfam ls]	395	418	1.4
LRR [Pfam ls]	422	443	1.2
LRR [Pfam ls]	445	469	7.2
LRR [Pfam ls]	564	588	0.0034
LRR [Pfam ls]	637	660	2.9

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	93	117	3.1
LRR [sensitive, ls]	93	117	61
LRR [sensitive, ls]	155	178	0.011
LRR [sensitive, ls]	155	178	0.22
LRR [sensitive, ls]	179	201	0.12
LRR [sensitive, ls]	179	201	2.4
LRR [sensitive, ls]	202	225	0.4
LRR [sensitive, ls]	202	225	7.9
LRR [sensitive, ls]	226	249	0.066
LRR [sensitive, ls]	226	249	1.3
LRR [sensitive, ls]	250	273	2
LRR [sensitive, ls]	250	273	39
LRR [sensitive, ls]	298	321	0.11
LRR [sensitive, ls]	298	321	2.1
LRR [sensitive, ls]	322	345	0.0092
LRR [sensitive, ls]	322	345	0.18
LRR [sensitive, ls]	346	369	0.021
LRR [sensitive, ls]	346	369	0.41
LRR [sensitive, ls]	370	394	0.59
LRR [sensitive, ls]	370	394	12
LRR [sensitive, ls]	395	418	0.072
LRR [sensitive, ls]	395	418	1.4
LRR [sensitive, ls]	422	443	0.063
LRR [sensitive, ls]	422	443	1.2
LRR [sensitive, ls]	445	469	0.37
LRR [sensitive, ls]	445	469	7.2
LRR [sensitive, ls]	472	495	1
LRR [sensitive, ls]	472	495	20
LRR [sensitive, ls]	516	539	0.88
LRR [sensitive, ls]	516	539	17
LRR [sensitive, ls]	540	563	1.6
LRR [sensitive, ls]	540	563	31
LRR [sensitive, ls]	564	588	0.00017
LRR [sensitive, ls]	564	588	0.0034
LRR [sensitive, ls]	589	609	2.8
LRR [sensitive, ls]	589	609	55
LRR [sensitive, ls]	613	636	1.6
LRR [sensitive, ls]	613	636	31
LRR [sensitive, ls]	637	660	0.14
LRR [sensitive, ls]	637	660	2.9
LRR [sensitive, ls]	661	681	5.7
LRR [sensitive, ls]	661	681	110
LRR [sensitive, ls]	691	716	7.4
LRR [sensitive, ls]	691	716	150
LRR [sensitive, ls]	761	784	0.63
LRR [sensitive, ls]	761	784	12

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	9	648	1e-43
Cf-9 [L. pimpinellifolium]	45	802	7e-73
CLV2 [A. thaliana]	47	719	2e-38
FLS2 [A.thaliana]	80	801	1e-59
FLS2 [A.thaliana]	94	631	1e-43
Cf-9 [L. pimpinellifolium]	97	338	5e-13
Cf-9 [L. pimpinellifolium]	97	392	3e-12
FLS2 [A.thaliana]	122	386	4e-16
Cf-9 [L. pimpinellifolium]	151	653	4e-42
FLS2 [A.thaliana]	155	717	2e-50
Xa21 [O. sativa]	156	763	1e-42
Cf-9 [L. pimpinellifolium]	173	804	3e-65
CLV2 [A. thaliana]	234	801	6e-41
Xa21 [O. sativa]	263	802	7e-38
CLV2 [A. thaliana]	264	804	3e-35
CLV2 [A. thaliana]	301	804	9e-27
Xa21 [O. sativa]	326	804	6e-24
CLV2 [A. thaliana]	513	804	5e-16

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	7	29	in -> out

Report for 4727.m00138

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)