Report for 4752.m00123

 > 4752.m00123, length: 1013, copies: 1 

MATPIALLLFVLVVAAAADSTMPMPVNEEVLGLVVFKSALSDPSGALATWTESDATPCGWAHVECDPATSRVLRL

ALDGLGLSGRMPRGLDRLAALQSLSVARNNLSGELPPGLSLLASLRSIDLSYNAFSGPLPGDVPLLASLRYLDLT

GNAFSGPLPATFPATVRFLMLSGNQFSGPLPQGLSKSSFLLHLNLSGNQLSGSPDFAGALWPLSRLRALDLSRNQ

FSGTVTTGIANLHNLKTIDLSGNRFFGAVPSDIGLCPHLSTVDISSNAFDGQLPDSIAHLGSLVYFAASGNRFSG

DVPAWLGDLAALQHLDFSDNALTGRLPDSLGKLKDLRYLSMSENQLSGAIPDAMSGCTKLAELHLRANNLSGSIP

DALFDVGLETLDMSSNALSGVLPSGSTKLAETLQWLDLSVNQITGGIPAEMALFMNLRYLNLSRNDLRTQLPPEL

GLLRNLTVLDLRSSGLYGTMPSDLCEAGSLAVLQLDGNSLAGPIPDNIGNCSSLYLLSLGHNSLTGPIPVGMSEL

KKLEILRLEYNNLSGEIPQQLGGIESLLAVNVSHNRLVGRLPASGVFQSLDASALEGNLGICSPLVTQPCRMNVA

KPLVLDPNEYPHGGDGDNNLETSGRGPASPRKRRFLSVSAMVAICAAVFIILGVIVITLLNMSARRRAGDGGTTT

PEKELESIVSSSTKSSKLATGKMVTFGPGNSLRSEDFVGGADALLSKATEIGRGVFGTVYRASVGEGRVVAIKKL

ATASIVESRDDFDREVRILGKARHPNLLPLKGYYWTPQLQLLITDYAPHGSLEARLHGNGDGAFPPLTWAERFRI

VAGTARGLAHLHQSFRPPMIHYNVKPSNILLDEQCNPMVGDFGLARLLPKLDKHVMSSRFQGGMGYVAPELACQS

LRINEKCDIYGFGVLILELVTGRRAVEYGDDDVVILIDQVRVLLDHGGGSNVLECVDPSIGEFPEEEVLPVLKLG

MVCTSQIPSNRPSMAEVVQILQVIKAPVAASSARIEAF

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	95	118	1.7
LRR [Pfam ls]	119	142	3.5
LRR [Pfam ls]	143	163	5.8
LRR [Pfam ls]	189	210	1.7
LRR [Pfam ls]	215	238	2.8
LRR [Pfam ls]	239	262	0.87
LRR [Pfam ls]	311	334	0.026
LRR [Pfam ls]	335	358	0.32
LRR [Pfam ls]	382	406	3.5
LRR [Pfam ls]	407	427	6.8
LRR [Pfam ls]	431	454	0.0072
LRR [Pfam ls]	479	502	2.1
LRR [Pfam ls]	503	526	7.9
LRR [Pfam ls]	527	550	0.74
Ser/Thr pkinase [Pfam fs]	720	922	2.6e-38
Ser/Thr pkinase [Pfam ls]	720	998	3.3e-35

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	95	118	0.086
LRR [sensitive, ls]	95	118	1.7
LRR [sensitive, ls]	119	142	0.18
LRR [sensitive, ls]	119	142	3.5
LRR [sensitive, ls]	143	163	0.29
LRR [sensitive, ls]	143	163	5.8
LRR [sensitive, ls]	165	188	0.73
LRR [sensitive, ls]	165	188	14
LRR [sensitive, ls]	189	210	0.089
LRR [sensitive, ls]	189	210	1.7
LRR [sensitive, ls]	215	238	0.14
LRR [sensitive, ls]	215	238	2.8
LRR [sensitive, ls]	239	262	0.044
LRR [sensitive, ls]	239	262	0.87
LRR [sensitive, ls]	263	286	0.9
LRR [sensitive, ls]	263	286	18
LRR [sensitive, ls]	287	310	3.6
LRR [sensitive, ls]	287	310	72
LRR [sensitive, ls]	311	334	0.0013
LRR [sensitive, ls]	311	334	0.026
LRR [sensitive, ls]	335	358	0.016
LRR [sensitive, ls]	335	358	0.32
LRR [sensitive, ls]	359	379	0.64
LRR [sensitive, ls]	359	379	13
LRR [sensitive, ls]	382	406	0.18
LRR [sensitive, ls]	382	406	3.5
LRR [sensitive, ls]	407	427	0.34
LRR [sensitive, ls]	407	427	6.8
LRR [sensitive, ls]	431	454	0.00036
LRR [sensitive, ls]	431	454	0.0072
LRR [sensitive, ls]	455	478	0.79
LRR [sensitive, ls]	455	478	15
LRR [sensitive, ls]	479	502	0.1
LRR [sensitive, ls]	479	502	2.1
LRR [sensitive, ls]	503	526	0.4
LRR [sensitive, ls]	503	526	7.9
LRR [sensitive, ls]	527	550	0.038
LRR [sensitive, ls]	527	550	0.74
LRR [sensitive, ls]	551	573	2.7
LRR [sensitive, ls]	551	573	53

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	5	579	4e-48
FLS2 [A.thaliana]	5	569	5e-68
Xa21 [O. sativa]	5	807	1e-71
CLV2 [A. thaliana]	7	566	1e-63
Cf-9 [L. pimpinellifolium]	68	609	4e-55
FLS2 [A.thaliana]	70	1000	2e-93
FLS2 [A.thaliana]	82	567	4e-61
CLV2 [A. thaliana]	84	556	1e-41
FLS2 [A.thaliana]	137	575	7e-58
CLV2 [A. thaliana]	190	568	1e-48
Cf-9 [L. pimpinellifolium]	363	583	6e-12
Rpg1 [Hordeum vulgare]	711	999	8e-22
Rpg1 [Hordeum vulgare]	721	999	4e-21
Pto [L. esculentum]	726	997	3e-30

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	638	660	out -> in

Report for 4752.m00123

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)