Report for 4767.m00161

 > 4767.m00161, length: 397, copies: 1 

MVAARRPRALMLLAAVLLVAVPVAAATLHPVDYLALQAVRRALSDMPGSRFFASWDFTGDPCGFAGVSCSGDGRV

VTLALGDPRAGAPGLSGALPAAALARLSELASLSLVPGRVSGELPPAVAALPSLRFLALAGNLLSGDLPATFSPM

LRTVDLSKNSFSGRIPPSLPLIRSLRTLVLSHNSLSGEIPKLVSSPLVHLDLRNNRLTGGVPPLPATLVYLSLAG

NRFSGRVGGVLRRLPRLSFLDLGGNWFSGEVPGEVFSFRISYLQLRKNAFSGELRPSGRVPAGATVDLSHNALSG

RVPAELAPAAAVYLNGNKFAGQVPREIAAAAEGGRMRVLFLQDNFLTGIGVGGVPASAAVCAHMNCVAPPPPVVA

ACPAKGGRGRRRPPSQCGGRRR

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	150	170	3.4
LRR [Pfam ls]	174	194	2.2
LRR [Pfam ls]	217	240	2.6
LRR [Pfam ls]	241	264	2.9

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	128	148	0.94
LRR [sensitive, ls]	128	148	10
LRR [sensitive, ls]	150	170	0.31
LRR [sensitive, ls]	150	170	3.4
LRR [sensitive, ls]	174	194	0.2
LRR [sensitive, ls]	174	194	2.2
LRR [sensitive, ls]	196	215	1.2
LRR [sensitive, ls]	196	215	13
LRR [sensitive, ls]	217	240	0.24
LRR [sensitive, ls]	217	240	2.6
LRR [sensitive, ls]	241	264	0.27
LRR [sensitive, ls]	241	264	2.9
LRR [sensitive, ls]	335	355	0.91
LRR [sensitive, ls]	335	355	9.9

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	10	361	4e-19
Xa21 [O. sativa]	32	348	8e-21
Xa21 [O. sativa]	80	324	9e-20
Cf-9 [L. pimpinellifolium]	86	327	8e-17
FLS2 [A.thaliana]	89	324	5e-22
Cf-9 [L. pimpinellifolium]	90	306	1e-20
Cf-9 [L. pimpinellifolium]	90	348	1e-15
CLV2 [A. thaliana]	90	324	2e-18
CLV2 [A. thaliana]	90	321	1e-16
FLS2 [A.thaliana]	90	328	6e-23
Xa21 [O. sativa]	90	327	9e-15
Xa21 [O. sativa]	90	274	1e-12
FLS2 [A.thaliana]	91	283	6e-15
Cf-9 [L. pimpinellifolium]	103	361	3e-12
FLS2 [A.thaliana]	103	327	9e-24
CLV2 [A. thaliana]	105	348	5e-19
CLV2 [A. thaliana]	132	348	2e-15

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	9	31	in -> out

Report for 4767.m00161

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)