Report for 4803.m00056

 > 4803.m00056, length: 1026, copies: 1 

MANLLLIPIIICYLVPIAVAVDAPPPVMAAAAVADDWSALLAFLSNVSADSGGVALADWGRSPEFCNWTGVVCGG

GERRRVTQLVLAGRGLRGVVSPALGRLEFVTVLDLSNNGFSGEIPAELASLSRLTQLSLTGNRLEGAIPAGIGLL

RRLYFLDLSGNRLSGGIPATLFCNCTALQYVDLANNSLAGDIPYSGECRLPSLRYLLLWSNDLSGLIPPALSNSS

LLEWVDFESNYLAGELPPQVFDRLPRLQYLYLSYNNLSSHGGNTDLAPFFRSLTNCTRLQELELAGNDLGGELPA

FVGELSREFRQIHLEDNAITGAIPPSIAGLVNLTYLNLSNNMLNGSIPPEMSRLRRLERLYLSNNLLAGEIPRSI

GEMPHLGLVDLSGNRLAGTIPDTFSNLTQLRRLMLHHNHLSGDVPASLGDCLNLEILDLSYNGLQGRIPPRVAAM

SGLKLYLNLSNNHLEGPLPLELGKMDMVLALDLSENALAGAVPAQLGGCVALEYLNLSGNALRGALPAPVAALPF

LQVLDVSRNRLSGELPVSSLQASTSLRDANFSCNNFSGAVPRGAGVLANLSAAAFRGNPGLCGYVPGIAACGAAT

ARRTRHRRAVLPAVVGIVAAVCAMLCAVVCRSMAAARAKRQSVRLVDVEDYQAAAEREHPRISYRELAEATGGFV

QSSLIGAGRFGRVYEGTLRGGARVAVKVLDPKGGGEVSGSFKRECEVLRRTRHKNLVRVITTCSTATFHALVLPL

MPHGSLEGHLYPPERGAGGGAGGGDGLDFGRLMSVVSDVAEGLAYLHHYAPVRVVHCDLKPSNVLLDDDMRAVIS

DFGIAKLISGAAAAVGDGGASSTSDESAPCNSITGLLQGSVGYIAPEYGLGGHPSRQGDVYSFGVMILELITGKR

PTDVIFHEGLTLHDWVRRHYPHDVAAVVAHAPWRREAPSPMSTAASPAAADVAAVELIELGLVCTQHSPALRPSM

VDVCHEITLLNEAIRRHAAAAAAIAAATDEDEDDDDGRSLSTTKDDSLFSN

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	104	127	0.043
LRR [Pfam ls]	128	151	0.47
LRR [Pfam ls]	152	176	0.0012
LRR [Pfam ls]	202	225	0.54
LRR [Pfam ls]	226	250	3.6
LRR [Pfam ls]	251	279	0.0048
LRR [Pfam ls]	283	306	0.81
LRR [Pfam ls]	308	331	3.8
LRR [Pfam ls]	332	355	0.0038
LRR [Pfam ls]	356	379	0.072
LRR [Pfam ls]	380	403	0.063
LRR [Pfam ls]	404	427	1.1
LRR [Pfam ls]	428	451	0.013
LRR [Pfam ls]	501	524	0.65
LRR [Pfam ls]	525	549	0.077
Ser/Thr pkinase [Pfam fs]	674	903	1.8e-46
Ser/Thr pkinase [Pfam ls]	674	984	1e-44

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	104	127	0.0018
LRR [sensitive, ls]	104	127	0.043
LRR [sensitive, ls]	128	151	0.02
LRR [sensitive, ls]	128	151	0.47
LRR [sensitive, ls]	152	176	5.2e-05
LRR [sensitive, ls]	152	176	0.0012
LRR [sensitive, ls]	177	201	0.54
LRR [sensitive, ls]	177	201	13
LRR [sensitive, ls]	202	225	0.023
LRR [sensitive, ls]	202	225	0.54
LRR [sensitive, ls]	226	250	0.16
LRR [sensitive, ls]	226	250	3.6
LRR [sensitive, ls]	251	279	0.00021
LRR [sensitive, ls]	251	279	0.0048
LRR [sensitive, ls]	283	306	0.035
LRR [sensitive, ls]	283	306	0.81
LRR [sensitive, ls]	308	331	0.17
LRR [sensitive, ls]	308	331	3.8
LRR [sensitive, ls]	332	355	0.00016
LRR [sensitive, ls]	332	355	0.0038
LRR [sensitive, ls]	356	379	0.0031
LRR [sensitive, ls]	356	379	0.072
LRR [sensitive, ls]	380	403	0.0027
LRR [sensitive, ls]	380	403	0.063
LRR [sensitive, ls]	404	427	0.046
LRR [sensitive, ls]	404	427	1.1
LRR [sensitive, ls]	428	451	0.00056
LRR [sensitive, ls]	428	451	0.013
LRR [sensitive, ls]	501	524	0.028
LRR [sensitive, ls]	501	524	0.65
LRR [sensitive, ls]	525	549	0.0033
LRR [sensitive, ls]	525	549	0.077

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	28	583	1e-74
Xa21 [O. sativa]	34	762	1e-112
CLV2 [A. thaliana]	36	553	1e-54
Cf-9 [L. pimpinellifolium]	59	575	8e-46
FLS2 [A.thaliana]	76	978	1e-106
Cf-9 [L. pimpinellifolium]	78	401	1e-26
Cf-9 [L. pimpinellifolium]	79	420	8e-25
CLV2 [A. thaliana]	79	592	6e-52
Cf-9 [L. pimpinellifolium]	81	591	1e-40
Cf-9 [L. pimpinellifolium]	100	541	5e-42
Cf-9 [L. pimpinellifolium]	310	591	2e-15
Pto [L. esculentum]	658	978	1e-23
Rpg1 [Hordeum vulgare]	663	983	1e-23
Rpg1 [Hordeum vulgare]	667	899	1e-13

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	609	631	out -> in
putative TM domain	609	631	out -> in
putative TM domain	731	753	in -> out
putative TM domain	731	753	in -> out

Report for 4803.m00056

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)