Report for 4847.m00209

 > 4847.m00209, length: 802, copies: 2 

MRRSPRAAAAAVLPVLLPLLLLLLNWAAAPVGAATAAETRALLEFKAAVTADPGAVLANWTLGGDPCRDFGGVSC

YPASGAVQRLRLHGEGLEGVLSPSLARLPALESVSLFGNRLSGVIPASFVGLAATLHKLNLSGNALSGEIPAFLG

TFPMLRLLDLSYNAFSGEIPATLFGECPRLRYVSLAHNALTGRVPPGIGNCVRLAGFDFSYNNLDGELPDKLCAP

PEMSYISVRSNSLSGAIDGKLDGCRSLDLFDVGSNSFSGAAPFGLLALVNITYFNVSSNNFAGEIPSIPTCGDRF

AYLDASRNKLTGSVPETMANCRNLMLLNLGANGQGLTGGIPAALSQLKNLNFLDLSENALTGVIPPELGDLSNLA

HFNVSFNNLTGSIPSSPLLQQFGPTAFMGNPFLCGPPLDHACPGRNARRLGVPVIVAIVIAAAILVGICIVSAMN

IKAYKNKRRREQQQHDDEEEILVSDSAAIVSPGSTAITGKLVLFRKNSSASRYEDWEAGTKAVLDRNCLVGVGSV

GAVYRASFESGASIAVKKLETLGRITSQEEFEREMGRLRGLTHPNLVTFHGYYWSPSTQLLLSEFVDNGSTLYDH

LHGSRRRAGPASTGGDGGGLPWERRFRIAVATARALAYLHHDCKPQVLHLNIKSRNILLDNEHEAKLSDFGLSKL

LPEPSNLPGYVAPELASSSMSSRHGGDKCDVFSFGVVLLEMVTGRKPVSSRHGRQGTVLVVVLRDYVREMVESGT

VSGCFDLSMRRFVEAELVQVLKLGLVCTSESPSRRPSMAEVVQFLESIRGSS

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	105	128	2.2
LRR [Pfam ls]	130	153	0.035
LRR [Pfam ls]	154	178	0.025
LRR [Pfam ls]	179	202	0.65
LRR [Pfam ls]	349	372	0.0056
LRR [Pfam ls]	373	395	5
Ser/Thr pkinase [Pfam fs]	514	724	5.1e-36
Ser/Thr pkinase [Pfam ls]	514	795	2.4e-32

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	105	128	0.096
LRR [sensitive, ls]	105	128	2.2
LRR [sensitive, ls]	130	153	0.0015
LRR [sensitive, ls]	130	153	0.035
LRR [sensitive, ls]	154	178	0.0011
LRR [sensitive, ls]	154	178	0.025
LRR [sensitive, ls]	179	202	0.028
LRR [sensitive, ls]	179	202	0.65
LRR [sensitive, ls]	203	226	1.2
LRR [sensitive, ls]	203	226	28
LRR [sensitive, ls]	251	272	1.4
LRR [sensitive, ls]	251	272	33
LRR [sensitive, ls]	275	297	0.58
LRR [sensitive, ls]	275	297	14
LRR [sensitive, ls]	299	322	0.58
LRR [sensitive, ls]	299	322	14
LRR [sensitive, ls]	323	348	0.63
LRR [sensitive, ls]	323	348	15
LRR [sensitive, ls]	349	372	0.00024
LRR [sensitive, ls]	349	372	0.0056
LRR [sensitive, ls]	373	395	0.22
LRR [sensitive, ls]	373	395	5

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	15	391	9e-44
FLS2 [A.thaliana]	38	391	3e-38
CLV2 [A. thaliana]	41	389	3e-35
Cf-9 [L. pimpinellifolium]	67	388	8e-14
CLV2 [A. thaliana]	71	389	4e-34
FLS2 [A.thaliana]	77	802	1e-65
Cf-9 [L. pimpinellifolium]	79	421	5e-32
CLV2 [A. thaliana]	81	390	3e-27
FLS2 [A.thaliana]	81	391	2e-35
Xa21 [O. sativa]	82	316	7e-22
Xa21 [O. sativa]	85	389	9e-31
FLS2 [A.thaliana]	92	388	6e-41
Xa21 [O. sativa]	99	602	5e-40
CLV2 [A. thaliana]	109	409	2e-29
Rpg1 [Hordeum vulgare]	503	798	9e-20
Pto [L. esculentum]	504	796	6e-27
Rpg1 [Hordeum vulgare]	523	798	2e-12

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End
putative coiled-coil	449	470

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	7	29	in -> out
putative TM domain	429	451	out -> in

Report for 4847.m00209

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)