Report for 4849.m00160

 > 4849.m00160, length: 1013, copies: 2 

MKVMPIGLLLLVLIAWSSEAVICNSLNESEIDRRSLLEFKKGISMDPQKALMSWNDSTLLCNWEGVLCRVKTPRR

VTSLNLTNRGLVGKISPSLGNLTFLKFLLLPTNSLTGEIPSSFGYLHRLQFLYLSNNTLQGMIPDLTNCSNLKAI

WLDSNDLVGQIPNILPPHLQQLQLYNNNLTGTIPSYLANITSLKELIFVSNQIEGNIPNEFAKLPNLKVLYAGAN

KLEGKFPQAILNISTLTGLSLAYNNLSGELPSNLFTYLPNLQDLGLAANLFQGHIPNSLANASKLYMLDIALNYF

TGIIPTSIGKLTELSWLNLEHHRLQARSKQDWEFMTSLANCSELNIFSMKDNLLEGHVPSSLGNLSVQLQHLLLG

TNKLSGDFPFGIANLPGLTMLGLEDNKFTGIVPEWLGSLQNLQGIELANNFFTGLIPSSLANISMLEELFLESNQ

LYGYIPSSLGKLNVLSVLSMSNNSLHGSIPEEIFRIPTIRKISLSFNNLDAPLHDDIGNAKQLTYLQLSSNNITG

YIPSTLGNCESLEDIELDHNVFSGSIPTTLGNIKTLKVLKLSNNNLTGSIPASLGNLQLLEQLDLSFNNLKGEVP

TKGIFKNATAMRVDGNEGLCGGSLELHLLTCSNKPLDSVKHKQSILLKVVLPMTIMVSLVAAISIMWFCKRKHKR

QSISSPSFGRKFPKVSYHDLVRATEGFSTSNLSGRGRYGSVYQGKLFEGRNVVAVKVFNLETRGAGKSFIAECNA

LKNVRHRNLVTILTACSSIDSAGNDFKALVYEFMPQGDLHNLLYSTRDGDGSSNLRNVSLAQRLSIAVDVSDALA

YLHHNHQGTIVHSDIKPSHILLNDDMTAHVGDFGLARFKSDSATSSFVNSNSTSSIAIKGTIGYVAPECAEDGQV

STASDVYSFGIVLLEIFIRKKPTDDMFKDGLSIVKYTEINLPEMLQIVDPQLLQELHIWHETPTDVEKNEVNCLL

SVLNIGLNCTRLVPSERMSMQEVASKLHGIRDEYLRGD

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	123	145	0.01
LRR [Pfam ls]	168	191	0.0067
LRR [Pfam ls]	192	215	0.52
LRR [Pfam ls]	240	264	0.023
LRR [Pfam ls]	289	312	5.3
LRR [Pfam ls]	368	391	1.4
LRR [Pfam ls]	392	415	0.18
LRR [Pfam ls]	416	439	0.19
LRR [Pfam ls]	440	463	5.4
LRR [Pfam ls]	512	535	0.015
LRR [Pfam ls]	536	559	3.8
LRR [Pfam ls]	560	583	0.0018
LRR [Pfam ls]	584	609	3.8
Ser/Thr pkinase [Pfam ls]	702	1004	8.8e-41
Ser/Thr pkinase [Pfam fs]	709	925	7.5e-45

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	75	98	0.56
LRR [sensitive, ls]	75	98	6.1
LRR [sensitive, ls]	99	122	0.86
LRR [sensitive, ls]	99	122	9.4
LRR [sensitive, ls]	123	145	0.00095
LRR [sensitive, ls]	123	145	0.01
LRR [sensitive, ls]	146	166	2.4
LRR [sensitive, ls]	146	166	26
LRR [sensitive, ls]	168	191	0.00061
LRR [sensitive, ls]	168	191	0.0067
LRR [sensitive, ls]	192	215	0.048
LRR [sensitive, ls]	192	215	0.52
LRR [sensitive, ls]	216	239	1.5
LRR [sensitive, ls]	216	239	16
LRR [sensitive, ls]	240	264	0.0021
LRR [sensitive, ls]	240	264	0.023
LRR [sensitive, ls]	265	288	0.61
LRR [sensitive, ls]	265	288	6.7
LRR [sensitive, ls]	289	312	0.48
LRR [sensitive, ls]	289	312	5.3
LRR [sensitive, ls]	343	366	2.2
LRR [sensitive, ls]	343	366	24
LRR [sensitive, ls]	368	391	0.12
LRR [sensitive, ls]	368	391	1.4
LRR [sensitive, ls]	392	415	0.016
LRR [sensitive, ls]	392	415	0.18
LRR [sensitive, ls]	416	439	0.018
LRR [sensitive, ls]	416	439	0.19
LRR [sensitive, ls]	440	463	0.49
LRR [sensitive, ls]	440	463	5.4
LRR [sensitive, ls]	464	487	0.54
LRR [sensitive, ls]	464	487	5.9
LRR [sensitive, ls]	488	511	1
LRR [sensitive, ls]	488	511	11
LRR [sensitive, ls]	512	535	0.0014
LRR [sensitive, ls]	512	535	0.015
LRR [sensitive, ls]	536	559	0.35
LRR [sensitive, ls]	536	559	3.8
LRR [sensitive, ls]	560	583	0.00016
LRR [sensitive, ls]	560	583	0.0018
LRR [sensitive, ls]	584	609	0.35
LRR [sensitive, ls]	584	609	3.8

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	1	600	7e-82
Cf-9 [L. pimpinellifolium]	6	618	3e-53
Xa21 [O. sativa]	6	815	1e-158
CLV2 [A. thaliana]	32	599	5e-57
Cf-9 [L. pimpinellifolium]	62	481	2e-39
CLV2 [A. thaliana]	69	309	8e-17
CLV2 [A. thaliana]	74	409	3e-28
FLS2 [A.thaliana]	74	633	3e-70
FLS2 [A.thaliana]	78	1006	1e-127
Cf-9 [L. pimpinellifolium]	100	621	5e-55
FLS2 [A.thaliana]	241	633	4e-54
CLV2 [A. thaliana]	337	631	2e-28
CLV2 [A. thaliana]	372	602	3e-23
FLS2 [A.thaliana]	377	602	1e-24
CLV2 [A. thaliana]	487	616	7e-13
Pto [L. esculentum]	677	1002	7e-26
Rpg1 [Hordeum vulgare]	686	1005	5e-21
Rpg1 [Hordeum vulgare]	699	1005	9e-17

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	649	668	out -> in

Report for 4849.m00160

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)