Report for 4849.m00161

 > 4849.m00161, length: 1013, copies: 2 

MKITAVGQLILVLMACSSHAVICSTFGNGTDQLSLLEFKKAISLDPQQSLISWNDSTNYCSWEGVSCSLKNPGRV

TSLNLTNRALVGHISPSLGNLTFLKYLALLKNALSGEIPPSLGHLRRLQYLYLSGNTLQGSIPSFANCSELKVLW

VHRNNLTGQFPADWPPNLQQLQLSINNLTGTIPASLANITSLNVLSCVYNHIEGNIPNEFAKLPNLQTLYVGSNQ

LSGSFPQVLLNLSTLINLSLGLNHLSGEVPSNLGSALPNLEIFELPVNFFHGRIPSSLTNASNLYFLELSNNNFT

GLVPRTIGELNKLQMLNLEWNQLQAHREQDWEFLQSLGNCTELQVFSMTGNRLQGHVPSSLGNLSDQLQELHLAE

SKLSGDFPSGIANLQNLIIVALGANLFTGVLPEWLGTIKTLQKVSLGSNFFTGAIPSSFSNLSQLGELYLDSNQL

VGQLPPSFGTLPILQVLIVSNNNLHGSIPKEIFRIPTIVQISLSFNNLDAPLHNDIGKAKQLTYLQLSSNNISGY

IPSTLGDSESLEDIELDHNVFSGSIPASLENIKTLKVLNLSYNNLSGSIPASLGNLQLVEQLDLSFNNLKGEVPT

KGIFKNTTAIRVGGNPGLCGGSLELHLLTCSSTPLNSVKHKQFIFLKVALPIAIMTSLVIAISIMWFWNRKQNRQ

SISSPSFGRKFPKVSYSDLVRATEGFSASNLIGRGRYGSVYQGKLFPERNLVAVKVFNLETRGAGKSFIAECNAL

KNVRHRNLITILTACSSIDSSGNDFKALVYEFMPRGDLHNLLYSTRDGNGSSNLSYVSLAQRLNIAVDVSDALAY

LHHNHQGSIVHSDLKPSNILLDDNMTAHVGDFGLAAFKSDSAASSFGDSSLTSSFAIKGTIGYVAPECAGGGRVS

TASDIYSFGIVLLEIFIRRKPTDDMFKDGLSISKYTEINFPDKMLQIVDPQLLRELDICQETSINVEKNEVCCLL

SVLNIGLHCTKLVPGERMSMQEVASKLHGIRDEYLRGY

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam fs]	122	144	3.5e-05
LRR [Pfam ls]	122	144	0.00061
LRR [Pfam ls]	167	190	0.056
LRR [Pfam ls]	191	214	3.5
LRR [Pfam ls]	215	238	0.27
LRR [Pfam ls]	288	311	0.015
LRR [Pfam ls]	342	365	0.9
LRR [Pfam ls]	367	390	0.57
LRR [Pfam ls]	415	438	0.7
LRR [Pfam ls]	439	462	0.19
LRR [Pfam ls]	463	487	2.8
LRR [Pfam ls]	511	534	0.17
LRR [Pfam ls]	535	558	1.2
LRR [Pfam ls]	559	582	0.0012
Ser/Thr pkinase [Pfam fs]	701	924	2.9e-48
Ser/Thr pkinase [Pfam ls]	701	1004	1.5e-44

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	74	97	0.63
LRR [sensitive, ls]	74	97	6.9
LRR [sensitive, ls]	98	121	1.4
LRR [sensitive, ls]	98	121	16
LRR [sensitive, ls]	122	144	5.5e-05
LRR [sensitive, ls]	122	144	0.00061
LRR [sensitive, ls]	145	165	1.1
LRR [sensitive, ls]	145	165	12
LRR [sensitive, ls]	167	190	0.0051
LRR [sensitive, ls]	167	190	0.056
LRR [sensitive, ls]	191	214	0.32
LRR [sensitive, ls]	191	214	3.5
LRR [sensitive, ls]	215	238	0.025
LRR [sensitive, ls]	215	238	0.27
LRR [sensitive, ls]	239	263	1.2
LRR [sensitive, ls]	239	263	13
LRR [sensitive, ls]	288	311	0.0013
LRR [sensitive, ls]	288	311	0.015
LRR [sensitive, ls]	312	341	1.6
LRR [sensitive, ls]	312	341	18
LRR [sensitive, ls]	342	365	0.082
LRR [sensitive, ls]	342	365	0.9
LRR [sensitive, ls]	367	390	0.052
LRR [sensitive, ls]	367	390	0.57
LRR [sensitive, ls]	391	414	7.9
LRR [sensitive, ls]	391	414	86
LRR [sensitive, ls]	415	438	0.064
LRR [sensitive, ls]	415	438	0.7
LRR [sensitive, ls]	439	462	0.017
LRR [sensitive, ls]	439	462	0.19
LRR [sensitive, ls]	463	487	0.26
LRR [sensitive, ls]	463	487	2.8
LRR [sensitive, ls]	511	534	0.016
LRR [sensitive, ls]	511	534	0.17
LRR [sensitive, ls]	535	558	0.11
LRR [sensitive, ls]	535	558	1.2
LRR [sensitive, ls]	559	582	0.00011
LRR [sensitive, ls]	559	582	0.0012
LRR [sensitive, ls]	583	607	0.79
LRR [sensitive, ls]	583	607	8.6

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	31	619	2e-56
Xa21 [O. sativa]	31	814	1e-159
Cf-9 [L. pimpinellifolium]	33	602	4e-55
FLS2 [A.thaliana]	34	599	2e-80
Cf-9 [L. pimpinellifolium]	67	323	3e-16
Cf-9 [L. pimpinellifolium]	75	620	1e-55
FLS2 [A.thaliana]	75	257	1e-15
FLS2 [A.thaliana]	77	1006	1e-126
FLS2 [A.thaliana]	78	767	4e-72
Cf-9 [L. pimpinellifolium]	93	599	6e-46
FLS2 [A.thaliana]	225	638	3e-50
Cf-9 [L. pimpinellifolium]	240	640	6e-30
FLS2 [A.thaliana]	330	613	3e-28
CLV2 [A. thaliana]	336	630	6e-28
Pto [L. esculentum]	668	952	6e-27
Rpg1 [Hordeum vulgare]	685	915	5e-20
Rpg1 [Hordeum vulgare]	698	915	8e-16

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	648	667	out -> in

Report for 4849.m00161

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)