Report for 4849.m00163

 > 4849.m00163, length: 759, copies: 1 

MKAPSVGELLLVFIACSCCAHVVCSSLPGNETDRLSLLEFKKAISGNISPSIANLTFLKSLSLGKNSFFGEIPAS

LGHLHRLQTLVLSYNKLQGRIPDLANCSNLRSLWLDRNNLVGKIPNLPPRLQELMLHVNNLSGTIPPSLGNITTL

TKFGCAFNNIEGNIPTEFERLPGLQYLSVNTNKLAGWFQLAILNISTLVTLDLGANNLRGEVPSNLGNSLPNLQY

LILSDNFFHGHFPSSLINSSKLNLIDMAENNFTGVIPSSIGKLAKLNVLSLQLNQFQAGTKKEWEFMDSLANCTE

LEVFSVARNHLQGQSFPPISYFGDIPNTLSNCESLEDIRLDRNAFTGIIPTSLGNIRSLKVLNLSHNKLTGSIPV

SLGNLQLLEQLDLSFNHLKGKVPTNGVFMNETAIQIDGKSWALWRRKHEGNSTSLPSFGRKFPKVPYNELAEATE

GFSESNLIGKGRYGYVYRGNLFQGTNVVAIKVFNLETMGAQKSFIAECNALRNVRHRNLVPILTACSSIDPNGND

FKALVYEFMPMGDLYNLLYAPQCDSNLRHITLAQRIGIVADVADAMDYLHHNNQGTIVHCDLKPSKILLDDNMTA

HVGDFGLVRFNFGSTTASLGDTNSTSSAAIKGTIGYIAPECAGGGQVSTAADVYSFGVVLLEIFIRRRPTDDMFK

DGLTIAKFTEINIPDKMQDIVDPQLAQELGLCEEAPMADEESGARCLLSVLNIGLCCTRLAPNERISMKEVASKM

HGIRGAYLR

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	81	103	0.029
LRR [Pfam ls]	104	123	3.2
LRR [Pfam ls]	125	148	0.18
LRR [Pfam ls]	197	221	0.35
LRR [Pfam ls]	222	245	1.9
LRR [Pfam ls]	246	269	1.6
LRR [Pfam ls]	334	357	0.63
LRR [Pfam fs]	358	381	2.5e-05
LRR [Pfam ls]	358	381	0.00042
Ser/Thr pkinase [Pfam fs]	452	672	4.5e-42
Ser/Thr pkinase [Pfam ls]	452	751	1.3e-37

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	57	80	0.53
LRR [sensitive, ls]	57	80	5.8
LRR [sensitive, ls]	81	103	0.0027
LRR [sensitive, ls]	81	103	0.029
LRR [sensitive, ls]	104	123	0.3
LRR [sensitive, ls]	104	123	3.2
LRR [sensitive, ls]	125	148	0.016
LRR [sensitive, ls]	125	148	0.18
LRR [sensitive, ls]	149	172	2.6
LRR [sensitive, ls]	149	172	29
LRR [sensitive, ls]	197	221	0.032
LRR [sensitive, ls]	197	221	0.35
LRR [sensitive, ls]	222	245	0.17
LRR [sensitive, ls]	222	245	1.9
LRR [sensitive, ls]	246	269	0.15
LRR [sensitive, ls]	246	269	1.6
LRR [sensitive, ls]	300	333	3.4
LRR [sensitive, ls]	300	333	37
LRR [sensitive, ls]	334	357	0.058
LRR [sensitive, ls]	334	357	0.63
LRR [sensitive, ls]	358	381	3.9e-05
LRR [sensitive, ls]	358	381	0.00042
LRR [sensitive, ls]	382	407	1.4
LRR [sensitive, ls]	382	407	15

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	14	398	4e-51
CLV2 [A. thaliana]	15	398	4e-34
Xa21 [O. sativa]	22	303	9e-28
Cf-9 [L. pimpinellifolium]	24	412	2e-27
Xa21 [O. sativa]	26	561	9e-78
FLS2 [A.thaliana]	29	282	3e-23
Xa21 [O. sativa]	29	399	7e-44
Cf-9 [L. pimpinellifolium]	31	398	4e-34
CLV2 [A. thaliana]	32	395	1e-27
FLS2 [A.thaliana]	32	755	3e-89
CLV2 [A. thaliana]	35	301	8e-17
FLS2 [A.thaliana]	44	398	1e-54
Xa21 [O. sativa]	44	399	1e-55
CLV2 [A. thaliana]	45	402	1e-31
CLV2 [A. thaliana]	45	400	2e-30
Cf-9 [L. pimpinellifolium]	58	410	1e-27
Xa21 [O. sativa]	123	388	1e-29
Xa21 [O. sativa]	198	410	5e-17
Pto [L. esculentum]	426	750	4e-27
Rpg1 [Hordeum vulgare]	445	741	3e-23
Rpg1 [Hordeum vulgare]	445	663	1e-18

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 4849.m00163

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)