Report for 4849.m00170

 > 4849.m00170, length: 1014, copies: 1 

MKFIEPGKFLLVFLVCSAHVVICSSNGNETDRLSLLEFKNAITLDPQQALMSWNDSNHVCSWEGVKCRVKAPHRV

IYLNLSGQGLVGTISPSLGNLTFLRYISLQENLLAGQIPLSLGHMHHLKVLYLSNNTLQGEIPDFANCSNLWALL

LNGNHLVGKVPTDARLPPNLYFLWIVHNNLTGTIPTSLFNITTLTKLSIGFNQINGEVPKEIGKSRVLQLFAASG

NKLLGRFQQTILNISSLADLDLGSNYLHGELPSSLGSSLSNLQGLALGNNFFGGHIPSSLANASKLSMIHLSRNN

FIGMVPSSIGKLQELSVLNLEFNQLQSSDKQGLEFMNSLSNCTKLRALSLAKNQLEGEIPSSFGNLSMKLELLYL

GGNKLSGRFPAGIANLHSLSGLALNSNRFTGPVPDWLGNLKNLQIIFLAANMFTGFIPSSLSNLSLLENVVLDSN

QFYGHIPRGLESLKVLQVLSIPNNNLHGSIPRELFSIPTIREIWLYSNRLDGPLPIEIGNAKQLEHLVLSSNNLS

GVIPDTLGNCESIEEIELDQNFLSGSIPTSFGNMESLQVLNMSHNLLSGSIPKSIGSLKYLEQLDLSFNNLEGEV

PEIGIFNNTTAIWIAGNRGLCGGATKLHLPVCTYRPPSSTKHLRSVVLKVVIPLACIVSLATGISVLLFWRKKHE

RKSMSLPSFGRNFPKVSFDDLSRATDGFSISNLIARGRYSSVYKGRLLQYGDMVAVKVFSLQTRGAQKSFIAECK

TLRNVRHRNLVPILTACSSIDSQGNDFKALVYQFMSQGDLHMMLYSNQDDENGSASIHIAFAQRLSIVVDVADAM

EYVHHNNQGTIVHCDLKPSNILLDDSLTAHVGDFGLARFKVDCTISSSGDSIISSAINGTIGYVAPEYATGGEVS

TFGDVYSFGIVLFEIFLRKRPTHDMFKDGLNIATFVDMNFPDRISEVVDQELLEYQNGLSHDTLVDMKEKEMECL

RSVLNIGLCCTKPSPYERMDMREVAARLRKIKEAYLSSN

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	74	97	2.9
LRR [Pfam ls]	122	144	0.001
LRR [Pfam ls]	169	192	4.2
LRR [Pfam ls]	241	265	1.9
LRR [Pfam ls]	290	313	3.1
LRR [Pfam ls]	344	367	0.031
LRR [Pfam ls]	369	392	0.044
LRR [Pfam ls]	393	416	2.1
LRR [Pfam ls]	417	440	0.23
LRR [Pfam ls]	513	536	0.0039
LRR [Pfam ls]	537	560	0.76
LRR [Pfam ls]	561	584	0.0041
LRR [Pfam ls]	585	607	1.8
Ser/Thr pkinase [Pfam fs]	703	924	2.9e-42
Ser/Thr pkinase [Pfam ls]	703	999	1e-36

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	74	97	0.27
LRR [sensitive, ls]	74	97	2.9
LRR [sensitive, ls]	98	121	0.61
LRR [sensitive, ls]	98	121	6.6
LRR [sensitive, ls]	122	144	9.4e-05
LRR [sensitive, ls]	122	144	0.001
LRR [sensitive, ls]	145	167	3.2
LRR [sensitive, ls]	145	167	35
LRR [sensitive, ls]	169	192	0.39
LRR [sensitive, ls]	169	192	4.2
LRR [sensitive, ls]	193	216	1
LRR [sensitive, ls]	193	216	11
LRR [sensitive, ls]	241	265	0.18
LRR [sensitive, ls]	241	265	1.9
LRR [sensitive, ls]	266	289	0.62
LRR [sensitive, ls]	266	289	6.8
LRR [sensitive, ls]	290	313	0.29
LRR [sensitive, ls]	290	313	3.1
LRR [sensitive, ls]	314	337	1
LRR [sensitive, ls]	314	337	11
LRR [sensitive, ls]	344	367	0.0029
LRR [sensitive, ls]	344	367	0.031
LRR [sensitive, ls]	369	392	0.004
LRR [sensitive, ls]	369	392	0.044
LRR [sensitive, ls]	393	416	0.2
LRR [sensitive, ls]	393	416	2.1
LRR [sensitive, ls]	417	440	0.021
LRR [sensitive, ls]	417	440	0.23
LRR [sensitive, ls]	441	464	2.6
LRR [sensitive, ls]	441	464	29
LRR [sensitive, ls]	465	488	0.62
LRR [sensitive, ls]	465	488	6.8
LRR [sensitive, ls]	489	512	2.7
LRR [sensitive, ls]	489	512	29
LRR [sensitive, ls]	513	536	0.00036
LRR [sensitive, ls]	513	536	0.0039
LRR [sensitive, ls]	537	560	0.069
LRR [sensitive, ls]	537	560	0.76
LRR [sensitive, ls]	561	584	0.00038
LRR [sensitive, ls]	561	584	0.0041
LRR [sensitive, ls]	585	607	0.16
LRR [sensitive, ls]	585	607	1.8

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	9	618	1e-82
Xa21 [O. sativa]	10	816	1e-152
Cf-9 [L. pimpinellifolium]	29	602	2e-54
CLV2 [A. thaliana]	31	629	1e-55
Cf-9 [L. pimpinellifolium]	54	630	3e-54
FLS2 [A.thaliana]	75	632	4e-71
FLS2 [A.thaliana]	76	210	3e-16
CLV2 [A. thaliana]	78	585	7e-47
FLS2 [A.thaliana]	78	1007	1e-140
Pto [L. esculentum]	673	975	9e-26
Rpg1 [Hordeum vulgare]	692	1006	2e-21
Rpg1 [Hordeum vulgare]	696	919	1e-17

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	650	669	out -> in

Report for 4849.m00170

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)