Report for 4849.m00171

 > 4849.m00171, length: 1003, copies: 1 

MCNSLYENGTDRLSLLEFKKAISMDPQQALMSWNDSNYFCSWEGVLCRVKTPHRVISLNLTNRGLVGQISPALGN

MTFLKFLSLSTNSFTGEIHLSLGHLHRLETLDLSNNTLQGDIPDFTNCSNLKSLWLSRNHLVGQFNSNFSPRLQD

LILASNNITGTIPSSLANITSLQRLSIMDNNINGNIPHEFAGFPILQILYADGNKLAGRFPRAILNIFTIVGLAF

SSNYLNGEIPSNLFDSLPEMQWFEVDYNNFFQGGIPSSLANASKLKVFDISRNNFTGVIPCSIGKLTKVYWLNLE

KNQLHARNKQDWEFMSCLANCTGLTDFSVSDNCLEGHVPSSLGNLSVQLQQFLLGGNQLSGVFPSGFQYLRNLIS

ISIDSNNFSGVLPEWLGSLQNLQLIGLYNNYFTGIIPSSLSNLSQLGYLYLQSNQFYGHLPPSLGNHKMLQELTI

GYKNIQGMIPKEIFKIPSLLQIDLSFNNLDGSIPKEVGDAKQLMYLRLSSNKLSGDIPNSLGNSESMEIIMLDRN

IFSGSIPTSLDNILSLKVLNLSQNNLSGSIPPSLGNLQFLEKLDLSFNHLKGEVPVKGIFKNASAIRIDGNEALC

GGVPELHLHARSIIPFDSTKHKQSIVLKIVIPLASMLSLAMIISILLLLNRKQKRKSVDLPSFGRKFVRVSYNDL

AKATEGFSTSHLIGRGRYSSVYQGKFTDEKVVAVKVFNLETMGAQKSFIIECNALRKLRHRNIVPILTACASTSS

NGNDFKALLYEFMPQGDLNKLLHSTGAEEFNRENHGNRITLAQRLSIIVDVADAIEYLHHNKQETIVHCDLKPSN

ILPDDDMIAHVGDFGLARFKIDFMGSNDSNSIYSTAIKGTIWICCPSIVSFRVNRSHPWRSIEYAAGAEVSTYGD

VFSFGVVLLEIFLRKKPTDDMFKDGLDIVKFVEVNFPDRLPQIVDPELLQETHVGTKERVLCCLNSVLNIGLFCT

KTSPYERMDMREVAARLSKIKEVFLSGN

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam fs]	102	124	4.9e-05
LRR [Pfam ls]	102	124	0.00087
LRR [Pfam ls]	147	170	0.12
LRR [Pfam ls]	171	194	0.53
LRR [Pfam ls]	219	243	4.9
LRR [Pfam ls]	269	292	0.053
LRR [Pfam ls]	323	346	4.8
LRR [Pfam ls]	348	371	4.2
LRR [Pfam ls]	372	395	2
LRR [Pfam ls]	396	419	0.0031
LRR [Pfam ls]	420	443	4.5
LRR [Pfam ls]	468	491	4.7
LRR [Pfam ls]	492	515	1.3
LRR [Pfam fs]	540	563	3.1e-05
LRR [Pfam ls]	540	563	0.00052
LRR [Pfam ls]	564	589	3.6
Ser/Thr pkinase [Pfam fs]	682	950	4.5e-38
Ser/Thr pkinase [Pfam ls]	682	981	1.1e-31

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	54	77	1.9
LRR [sensitive, ls]	54	77	21
LRR [sensitive, ls]	78	101	0.6
LRR [sensitive, ls]	78	101	6.5
LRR [sensitive, ls]	102	124	8e-05
LRR [sensitive, ls]	102	124	0.00087
LRR [sensitive, ls]	125	145	0.66
LRR [sensitive, ls]	125	145	7.3
LRR [sensitive, ls]	147	170	0.011
LRR [sensitive, ls]	147	170	0.12
LRR [sensitive, ls]	171	194	0.048
LRR [sensitive, ls]	171	194	0.53
LRR [sensitive, ls]	219	243	0.45
LRR [sensitive, ls]	219	243	4.9
LRR [sensitive, ls]	244	268	6.7
LRR [sensitive, ls]	244	268	74
LRR [sensitive, ls]	269	292	0.0049
LRR [sensitive, ls]	269	292	0.053
LRR [sensitive, ls]	323	346	0.44
LRR [sensitive, ls]	323	346	4.8
LRR [sensitive, ls]	348	371	0.38
LRR [sensitive, ls]	348	371	4.2
LRR [sensitive, ls]	372	395	0.18
LRR [sensitive, ls]	372	395	2
LRR [sensitive, ls]	396	419	0.00029
LRR [sensitive, ls]	396	419	0.0031
LRR [sensitive, ls]	420	443	0.41
LRR [sensitive, ls]	420	443	4.5
LRR [sensitive, ls]	468	491	0.43
LRR [sensitive, ls]	468	491	4.7
LRR [sensitive, ls]	492	515	0.12
LRR [sensitive, ls]	492	515	1.3
LRR [sensitive, ls]	516	539	5.9
LRR [sensitive, ls]	516	539	65
LRR [sensitive, ls]	540	563	4.7e-05
LRR [sensitive, ls]	540	563	0.00052
LRR [sensitive, ls]	564	589	0.33
LRR [sensitive, ls]	564	589	3.6

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	11	580	6e-54
Xa21 [O. sativa]	11	796	1e-158
Cf-9 [L. pimpinellifolium]	13	605	7e-50
FLS2 [A.thaliana]	14	605	8e-76
CLV2 [A. thaliana]	31	389	4e-24
Cf-9 [L. pimpinellifolium]	47	304	3e-14
Cf-9 [L. pimpinellifolium]	55	601	7e-49
FLS2 [A.thaliana]	57	996	1e-124
CLV2 [A. thaliana]	62	531	3e-37
CLV2 [A. thaliana]	260	581	2e-41
FLS2 [A.thaliana]	311	613	4e-33
CLV2 [A. thaliana]	318	604	1e-27
CLV2 [A. thaliana]	354	604	1e-22
Rpg1 [Hordeum vulgare]	648	995	6e-16
Pto [L. esculentum]	669	948	4e-20
Rpg1 [Hordeum vulgare]	675	995	1e-17

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	630	649	out -> in

Report for 4849.m00171

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)