Report for 4849.m00172

 > 4849.m00172, length: 1012, copies: 1 

MKIATIRQYMILLMASNVVQIMCTSLYGNETDRLSLLEFKKAISLDPQQALMSWNDSTYFCSWEGVLCRVKTPHR

PISLNLTNQGLVGQISPSLGNLTFLKFLFLDTNSFTGEIPLSLGHLHHLRTIYLSNNTLEGAIPDFTNCSSLKAL

WLNGNHLVGQLINNFPPKLQVLTLASNNFTGTIPSSFANITELRNLNFASNNIKGNIPNEFSNFLMMEILILGGN

MLTGRFPQAILNISTLIDLFLNFNHLSGEVPSNILYSLPNLQVLALDFNFLQGHIPSSLVNASNLRELDISSNNF

TGVVPSSIGKLSKLYWLSLEGNQLQTHKKEDWEFMNSLANCTRLQIFSMAYNRLEGHLPSSLSNFSTHLQRLHLY

GNEISGFLPSGIEHLSNLIDLSLGTNDFTGTLPEWLGNLKQLQMLGLYENYFIGFIPSSLSNLSQLVYLGLHFNK

FDGHIPSLGNLQMLEVLNISNNNLHCIIPTEIFSIMSIVQIDLSFNNLHRKFSTDIGNAKQLISLELSSNKLSGD

IPNALGNCESLEYIMLGINSFSGSIPISLGNISNLKVLNLSHNNLTWSIPASLSNLQYLEQLDLSFNHLNGEVPV

EGIFKNATAFQMDGNQGLCGGLPELHLPACPTVLLVTSKNKNSVILKLVIPLACMVSLALAISIYFIGRGKRKKK

SISFPSLGRKFPKVSFNDLSNATDRFSTANLIGRGRFGSVYQAKLFQDNIVVAVKVFNLETSGSQESFIAECNAL

RNLRHRNLVPIFTLCGSIDAEGNDFKALVYELMPRGDLHKLLYSTGDDGDASNLNHITLAQRISIIVDLSNALEY

LHHNNQGTIIHCDLKPSNILLDDNMIAHVGDFGLVKFRTDSSTSFGDSNSIFSLAIKGTIGYIAPECAEGDQVST

ASDVYSFGVVLLELFICRRPIDAMFKDGLSIAKFTEINFSDRILEIVDPQLQQELDLCLEAPVEVKEKDIHCMLS

VLKIGIHCTKPIPSERISMREAAAKLHIIKDAYLRGN

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	123	145	0.015
LRR [Pfam ls]	168	191	0.029
LRR [Pfam ls]	192	215	0.5
LRR [Pfam ls]	240	264	1.7
LRR [Pfam ls]	265	288	3.7
LRR [Pfam fs]	289	312	4e-05
LRR [Pfam ls]	289	312	0.00067
LRR [Pfam ls]	343	366	4
LRR [Pfam ls]	368	391	0.0098
LRR [Pfam ls]	392	415	1.5
LRR [Pfam ls]	416	439	0.71
LRR [Pfam ls]	440	462	1.1
LRR [Pfam ls]	463	484	5.1
LRR [Pfam ls]	511	534	0.071
LRR [Pfam fs]	559	582	1.8e-05
LRR [Pfam ls]	559	582	0.00029
LRR [Pfam ls]	583	608	4.4
Ser/Thr pkinase [Pfam fs]	701	915	3.8e-49
Ser/Thr pkinase [Pfam ls]	701	1003	8.9e-47

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	75	98	2.8
LRR [sensitive, ls]	75	98	30
LRR [sensitive, ls]	99	122	0.61
LRR [sensitive, ls]	99	122	6.6
LRR [sensitive, ls]	123	145	0.0013
LRR [sensitive, ls]	123	145	0.015
LRR [sensitive, ls]	146	166	0.9
LRR [sensitive, ls]	146	166	9.9
LRR [sensitive, ls]	168	191	0.0026
LRR [sensitive, ls]	168	191	0.029
LRR [sensitive, ls]	192	215	0.045
LRR [sensitive, ls]	192	215	0.5
LRR [sensitive, ls]	216	239	3.9
LRR [sensitive, ls]	216	239	43
LRR [sensitive, ls]	240	264	0.16
LRR [sensitive, ls]	240	264	1.7
LRR [sensitive, ls]	265	288	0.34
LRR [sensitive, ls]	265	288	3.7
LRR [sensitive, ls]	289	312	6.1e-05
LRR [sensitive, ls]	289	312	0.00067
LRR [sensitive, ls]	313	342	1.4
LRR [sensitive, ls]	313	342	16
LRR [sensitive, ls]	343	366	0.36
LRR [sensitive, ls]	343	366	4
LRR [sensitive, ls]	368	391	0.00089
LRR [sensitive, ls]	368	391	0.0098
LRR [sensitive, ls]	392	415	0.14
LRR [sensitive, ls]	392	415	1.5
LRR [sensitive, ls]	416	439	0.065
LRR [sensitive, ls]	416	439	0.71
LRR [sensitive, ls]	440	462	0.097
LRR [sensitive, ls]	440	462	1.1
LRR [sensitive, ls]	463	484	0.46
LRR [sensitive, ls]	463	484	5.1
LRR [sensitive, ls]	487	510	1.7
LRR [sensitive, ls]	487	510	18
LRR [sensitive, ls]	511	534	0.0064
LRR [sensitive, ls]	511	534	0.071
LRR [sensitive, ls]	535	558	1.5
LRR [sensitive, ls]	535	558	17
LRR [sensitive, ls]	559	582	2.7e-05
LRR [sensitive, ls]	559	582	0.00029
LRR [sensitive, ls]	583	608	0.4
LRR [sensitive, ls]	583	608	4.4

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	30	617	5e-56
CLV2 [A. thaliana]	32	623	3e-54
Xa21 [O. sativa]	32	814	1e-157
FLS2 [A.thaliana]	35	616	8e-76
Cf-9 [L. pimpinellifolium]	78	432	7e-28
FLS2 [A.thaliana]	78	1011	1e-127
Cf-9 [L. pimpinellifolium]	94	599	7e-50
Cf-9 [L. pimpinellifolium]	95	479	4e-42
Cf-9 [L. pimpinellifolium]	100	629	7e-57
Cf-9 [L. pimpinellifolium]	241	621	5e-37
Rpg1 [Hordeum vulgare]	670	969	7e-17
Pto [L. esculentum]	671	955	5e-27
Rpg1 [Hordeum vulgare]	685	914	5e-21

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	648	667	out -> in

Report for 4849.m00172

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)