Report for 4849.m00176

 > 4849.m00176, length: 959, copies: 2 

MKITIIGLFQLLLMVCSAVQIICSSLYGNETDKLSLLEFKKAITLDPQQVLISWNDSNHFCSWEGVLCRKKTTNR

VISLNLTNQRLVGVISPSLGNLTFLKFLYLDTNSFTGEIPLSLGHLHHLQNLYLSNNTLQGKIPDFTNSSNLKVL

LLNGNHLIGQFNNNFPPHLQGLDLSFNNLTGTIPSSLANITELLGVGFMSNNIKGNIPNDFSKFVSIGYLAASQN

MLSGRFPQAILNLSTLDVLYLGFNHLSGDLPSNLLDSLPSIEILSLGGNFFQGHIPCSVVNSSNLGLLDISSNNF

TGLVPSSIGKPTKLYHLNLQSNQLQAHRKQDWDFMNGLTNCTRLQMISIANNRLQGHLPSSLGNLSSQLGMLHLG

GNQISGVLPSDIENLSSLTYFRIDTNEITGVLPEWLGSLKHLQVLGLFNNNFTGFIPPSLSNLSQLCFPQQSSRW

TTSCGNAKQLSKLSLASNKLSGDIPNTLGDFESLEYIDLSWNNFTGIIPASIGKITSLEVLKFSHNNLTGPIPSL

LGDLHFLEQLDLSFNHLKGEVPMKGIFQNVTALSIGGNEGLCGGSRELHLLACPVISLVSSKHKKSILLKILIPV

ACLVSLAMVISIFFTWRGKRKRESLSLPSFGTNFPNFSYNNLFKATEGFSSSNLIGKGRYSYVYVGKLFQDNIVA

VKVFSLETRGAHKSFMAECNALRNVRHRNLLPILTACSSIDSEGNDFKALVYEFMSQGDLHKFLYTTRDDINLSN

LNHITLAQRISIVVDVSDALEYLHHNNQWTIVHCDLKPSNILLDDDMIAHVGDFGLASYKTNSSMPSLGDSNSTS

SLAIKGTIGYIAPECSHGGQVSTASDVYSFGVVVLEIFIRRRPTDDMFKDGLSIAKYAEINFPDRILEIVDPQLQ

LELDGQETPMAVKEKGLHYLHSVLNIGLCCTKMTPSERISMQEAAAKLHGIRDAYLRGN

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	99	122	3.7
LRR [Pfam ls]	123	145	0.0082
LRR [Pfam ls]	168	191	0.0049
LRR [Pfam ls]	240	264	0.021
LRR [Pfam ls]	289	312	0.097
LRR [Pfam ls]	343	366	0.17
LRR [Pfam ls]	368	391	0.41
LRR [Pfam ls]	392	415	3.6
LRR [Pfam ls]	416	439	0.028
LRR [Pfam ls]	459	482	2.3
LRR [Pfam ls]	483	506	0.018
LRR [Pfam ls]	507	530	0.0059
LRR [Pfam ls]	531	556	3.5
Ser/Thr pkinase [Pfam fs]	649	871	3.7e-44
Ser/Thr pkinase [Pfam ls]	649	950	1e-40

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	75	98	0.87
LRR [sensitive, ls]	75	98	9.5
LRR [sensitive, ls]	99	122	0.34
LRR [sensitive, ls]	99	122	3.7
LRR [sensitive, ls]	123	145	0.00075
LRR [sensitive, ls]	123	145	0.0082
LRR [sensitive, ls]	146	166	1.3
LRR [sensitive, ls]	146	166	14
LRR [sensitive, ls]	168	191	0.00045
LRR [sensitive, ls]	168	191	0.0049
LRR [sensitive, ls]	216	239	6.7
LRR [sensitive, ls]	216	239	74
LRR [sensitive, ls]	240	264	0.0019
LRR [sensitive, ls]	240	264	0.021
LRR [sensitive, ls]	265	288	1.2
LRR [sensitive, ls]	265	288	13
LRR [sensitive, ls]	289	312	0.0088
LRR [sensitive, ls]	289	312	0.097
LRR [sensitive, ls]	313	342	1.2
LRR [sensitive, ls]	313	342	13
LRR [sensitive, ls]	343	366	0.015
LRR [sensitive, ls]	343	366	0.17
LRR [sensitive, ls]	368	391	0.038
LRR [sensitive, ls]	368	391	0.41
LRR [sensitive, ls]	392	415	0.33
LRR [sensitive, ls]	392	415	3.6
LRR [sensitive, ls]	416	439	0.0025
LRR [sensitive, ls]	416	439	0.028
LRR [sensitive, ls]	459	482	0.21
LRR [sensitive, ls]	459	482	2.3
LRR [sensitive, ls]	483	506	0.0017
LRR [sensitive, ls]	483	506	0.018
LRR [sensitive, ls]	507	530	0.00054
LRR [sensitive, ls]	507	530	0.0059
LRR [sensitive, ls]	531	556	0.32
LRR [sensitive, ls]	531	556	3.5

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	1	564	1e-47
CLV2 [A. thaliana]	1	565	2e-52
FLS2 [A.thaliana]	20	714	9e-66
Xa21 [O. sativa]	32	761	1e-124
FLS2 [A.thaliana]	35	558	1e-66
CLV2 [A. thaliana]	73	443	1e-26
Cf-9 [L. pimpinellifolium]	76	568	4e-52
FLS2 [A.thaliana]	78	952	1e-111
CLV2 [A. thaliana]	83	567	1e-42
CLV2 [A. thaliana]	296	568	6e-18
FLS2 [A.thaliana]	299	564	8e-23
Rpg1 [Hordeum vulgare]	618	862	5e-18
Pto [L. esculentum]	637	899	3e-25
Rpg1 [Hordeum vulgare]	637	862	8e-21

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	592	614	out -> in

Report for 4849.m00176

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)