Report for 4849.m00182

 > 4849.m00182, length: 1024, copies: 1 

MKFTTIRQYLLVLMASSIIKIMCSSLYGNETDRLSLLEFKKAISMDPQQALMSWNDSNYFCSWEGVSCRVKTPHR

VISLNLTNRGLIGQMSPSLGNLTFLKFLFLPANSFTGEIPQSLGNMHHLQIIYLSNNTLQGKIPNLANCSNLKVL

WLNGNNLVGQIPADLPQRFQSLQLSINSLTGPIPVYVANITTLKRFSCLYNNIDGNIPDDFAKLPVLVYLHLGAN

KLAGQFPQAILNLSTLVELTLASNHLSGELPSNIGDSVPNLQKFQLGGNFFYGHIPNSLTNASKLNLIDISINSF

TGVVPRSIGKLTKLSWLNLELNKFHAHSQKDLEFMNSLANCTELQMFSIYGNRFEGNVPNSFGNHSTQLQYIHMG

LNQFSGLIPSGIANIPNLIALELGGNLFTTVIPDWLGGLKSLQTLSLFNNLFTGPIPPSLSNLSNLVELGLSTNQ

LDGYIPPSLGYLQVLEEFTISHNNINGWVPNEIFGIPTISLIWLSFNYLEGELPSEVGNAKQLMYLHLTSNKLSG

DIPSTLGNCESLVDIKLDQNVFTGNIPITLGNISSLRGLNLSHNNLSGTIPVSLGDLELLQQLDLSFNHLTGHVP

XKGVFKNTTAIQIDGNQGLCGGIPELHLLECPVMPLNSTKHKHSVGLKVVIPLATTVSLAVTIVFALFFWREKQK

RKSVSLPSFDSSFPKVSYHDLARATDGFSASNLIGRGRYGSVYKAQLFQGRNVVAVKVFSLETKGAQKSFIAECN

ALRNVRHRNLVPILTACSTIDSRGNDFKALVYKFMTRGDLYELLYSTGDDENTSTSNHITLAQRLSIIVDVADAL

EYLHHNNQGTIVHCDLKPSNILLDDNMTAHVGDFGLARLKIDSTASTSADSTSSIAIKGTIGYIAPECASGGGQV

STVADVYSFGIILLEIFLRKRPTDNMFKDGLDIAKYVEMNSPDRTLNIVDPELLDDKQLQEIPVTMKEKCIECLV

SVLNTGLCCVKISPNERMAMQEVAARLHVIKEAYAKAISDSQAVISDKT

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	123	145	0.015
LRR [Pfam ls]	146	166	0.22
LRR [Pfam ls]	240	264	3.6
LRR [Pfam ls]	289	312	1.8
LRR [Pfam ls]	392	415	0.016
LRR [Pfam ls]	416	439	0.073
LRR [Pfam ls]	440	463	2
LRR [Pfam ls]	512	535	1.3
LRR [Pfam ls]	560	583	0.0047
LRR [Pfam ls]	584	609	1.2
Ser/Thr pkinase [Pfam fs]	703	925	5.3e-47
Ser/Thr pkinase [Pfam ls]	703	1004	2.9e-43

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	75	98	5.2
LRR [sensitive, ls]	75	98	57
LRR [sensitive, ls]	99	122	0.93
LRR [sensitive, ls]	99	122	10
LRR [sensitive, ls]	123	145	0.0014
LRR [sensitive, ls]	123	145	0.015
LRR [sensitive, ls]	146	166	0.02
LRR [sensitive, ls]	146	166	0.22
LRR [sensitive, ls]	168	191	1.4
LRR [sensitive, ls]	168	191	15
LRR [sensitive, ls]	192	215	4.5
LRR [sensitive, ls]	192	215	49
LRR [sensitive, ls]	216	239	1.7
LRR [sensitive, ls]	216	239	18
LRR [sensitive, ls]	240	264	0.32
LRR [sensitive, ls]	240	264	3.6
LRR [sensitive, ls]	265	288	1.2
LRR [sensitive, ls]	265	288	13
LRR [sensitive, ls]	289	312	0.16
LRR [sensitive, ls]	289	312	1.8
LRR [sensitive, ls]	343	366	0.64
LRR [sensitive, ls]	343	366	7
LRR [sensitive, ls]	368	391	0.95
LRR [sensitive, ls]	368	391	10
LRR [sensitive, ls]	392	415	0.0014
LRR [sensitive, ls]	392	415	0.016
LRR [sensitive, ls]	416	439	0.0066
LRR [sensitive, ls]	416	439	0.073
LRR [sensitive, ls]	440	463	0.18
LRR [sensitive, ls]	440	463	2
LRR [sensitive, ls]	488	511	1.2
LRR [sensitive, ls]	488	511	13
LRR [sensitive, ls]	512	535	0.12
LRR [sensitive, ls]	512	535	1.3
LRR [sensitive, ls]	536	559	3.4
LRR [sensitive, ls]	536	559	37
LRR [sensitive, ls]	560	583	0.00043
LRR [sensitive, ls]	560	583	0.0047
LRR [sensitive, ls]	584	609	0.11
LRR [sensitive, ls]	584	609	1.2

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	3	625	3e-54
CLV2 [A. thaliana]	32	599	1e-52
Xa21 [O. sativa]	32	816	1e-160
FLS2 [A.thaliana]	35	630	5e-77
Cf-9 [L. pimpinellifolium]	68	322	1e-21
Cf-9 [L. pimpinellifolium]	76	621	7e-57
FLS2 [A.thaliana]	78	1002	1e-125
CLV2 [A. thaliana]	79	511	2e-33
CLV2 [A. thaliana]	296	631	2e-30
Pto [L. esculentum]	673	1002	4e-26
Rpg1 [Hordeum vulgare]	675	1015	8e-19
Rpg1 [Hordeum vulgare]	692	925	6e-22

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	649	671	out -> in

Report for 4849.m00182

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)