Report for 4861.m00147

 > 4861.m00147, length: 735, copies: 1 

MGAKATDDSGAETEAEALLRWKSTLIDATNSLSSWSIANSTCSWFGVTCDAAGHVTELDLLGADINGTLDALYSA

AFENLTTIDLSHNNLDGAIPANISMLHTLTVLDLSVNNLTGTIPYQLSKLPRLAHLNLGDNHLTNPEYAMFFTPM

PCLEFLSLFHNHLNGTFPEFILNSTSLRMEHLDLSGNAFSGPIPDSLPEIAPNLRHLDLSYNGFHGSIPHSLSRL

QKLRELYLHRNNLTRAIPEELGNLTNLEELVLSSNRLVGSLPPSFARMQQLSFFAIDNNYINGSIPLEMFSNCTQ

LMIFDVSNNMLTGSIPSLISNWTHLQYLFLFNNTFTGAIPREIGNLAQLLSVDMSQNLFTGKIPLNICNASLLYL

VISHNYLEGELPECLWNLKDLGYMDLSSNAFSGEVTTSSNYESSLKSLYLSNNNLSGRFPTVLKNLKNLTVLDLV

HNKISGVIPSWIGESNPLLRILRLRSNLFHGSIPCQLSKLSQLQLLDLAENNFTGPVPSSFANLSSMQPETRDKF

SSGETYYINIIWKGMEYTFQERDDCVIGIDLSSNSLSGEIPSELTNLRGLQFLNMSRNVLYGGIPNDIGHLHVVE

SLDLSCNRLLGPIPPSISNLTGLSKLNLSNNLLSGEIPIGNQLQTLDDPSIYANNLRLCGFPLKIPCSNHSNSTS

TLEGAKEHHQELETLWLYCSVTAGAVFGVWLWFGALFFCNAWRLAFFSLIDAMQQKLMQT

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	79	102	0.16
LRR [Pfam ls]	103	126	0.027
LRR [Pfam ls]	178	198	0.36
LRR [Pfam ls]	203	226	0.0074
LRR [Pfam ls]	227	250	0.0032
LRR [Pfam ls]	251	274	0.022
LRR [Pfam ls]	300	323	5.5
LRR [Pfam ls]	324	347	0.71
LRR [Pfam ls]	371	394	0.84
LRR [Pfam ls]	419	442	0.0054
LRR [Pfam ls]	443	466	0.087
LRR [Pfam ls]	492	515	0.0057
LRR [Pfam ls]	550	573	3
LRR [Pfam ls]	574	597	0.69
LRR [Pfam ls]	598	621	1.4
LRR [Pfam ls]	622	644	5.6

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	79	102	0.0077
LRR [sensitive, ls]	79	102	0.16
LRR [sensitive, ls]	103	126	0.0013
LRR [sensitive, ls]	103	126	0.027
LRR [sensitive, ls]	127	150	1.2
LRR [sensitive, ls]	127	150	25
LRR [sensitive, ls]	152	175	0.47
LRR [sensitive, ls]	152	175	9.8
LRR [sensitive, ls]	178	198	0.018
LRR [sensitive, ls]	178	198	0.36
LRR [sensitive, ls]	203	226	0.00036
LRR [sensitive, ls]	203	226	0.0074
LRR [sensitive, ls]	227	250	0.00016
LRR [sensitive, ls]	227	250	0.0032
LRR [sensitive, ls]	251	274	0.001
LRR [sensitive, ls]	251	274	0.022
LRR [sensitive, ls]	275	299	0.73
LRR [sensitive, ls]	275	299	15
LRR [sensitive, ls]	300	323	0.26
LRR [sensitive, ls]	300	323	5.5
LRR [sensitive, ls]	324	347	0.034
LRR [sensitive, ls]	324	347	0.71
LRR [sensitive, ls]	348	368	5.9
LRR [sensitive, ls]	348	368	120
LRR [sensitive, ls]	371	394	0.04
LRR [sensitive, ls]	371	394	0.84
LRR [sensitive, ls]	419	442	0.00026
LRR [sensitive, ls]	419	442	0.0054
LRR [sensitive, ls]	443	466	0.0042
LRR [sensitive, ls]	443	466	0.087
LRR [sensitive, ls]	468	491	0.53
LRR [sensitive, ls]	468	491	11
LRR [sensitive, ls]	492	515	0.00028
LRR [sensitive, ls]	492	515	0.0057
LRR [sensitive, ls]	550	573	0.14
LRR [sensitive, ls]	550	573	3
LRR [sensitive, ls]	574	597	0.033
LRR [sensitive, ls]	574	597	0.69
LRR [sensitive, ls]	598	621	0.069
LRR [sensitive, ls]	598	621	1.4
LRR [sensitive, ls]	622	644	0.27
LRR [sensitive, ls]	622	644	5.6

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	3	704	7e-65
FLS2 [A.thaliana]	12	668	3e-73
CLV2 [A. thaliana]	17	716	2e-67
Cf-9 [L. pimpinellifolium]	34	656	4e-61
FLS2 [A.thaliana]	47	674	4e-83
Cf-9 [L. pimpinellifolium]	58	388	2e-21
Cf-9 [L. pimpinellifolium]	80	735	2e-73
FLS2 [A.thaliana]	296	697	3e-51

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	703	725	out -> in

Report for 4861.m00147

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)