Report for 4924.m00114

 > 4924.m00114, length: 1074, copies: 1 

MATTSSACVSIAVLVVVLSSTSCYSSPSPTTTANGSSDTDLAALLAFKSQLTDPLGVLTSNWSTSTSFCHWLGVT

CSRRRRHRRVTGLSLPHTPLHGPITPLLGNLSFLSFLRLTDTNLTASIPADLGKLRRLRHLCLGENSLSGRIPPD

LGNLARLEVLELGSNQLSGQIPPELLLHLHNLQVISLEGNSLSGQIPSFLFNNTPSLRYLSFGNNSLSGPIPDGV

ASLSQLEILDMQYNQLSSLVPQALYNMSWLRVMALAGNGNLTGPIPNNNQTFRLPMLRFISLARNRIAGRFPAGL

ASCQYLREIYLYSNSFVDVLPTWLAKLSRLEVVSLGGNKLVGTIPAVLSNLTRLTVLELSFGNLTGNIPPEIGLL

QKLVYLLLSANQLSGSVPRTLGNIAALQKLVLPHNNLEGNMGFLSSLSECRQLEDLILDHNSFVGALPDHLGNLS

ARLISFIADHNKLAGSLPEKMSNLSSLELIDLGYNQLTGAIPESIATMGNLGLLDVSNNHILGPLPTQIGTLLSI

QRLFLERNKISGSIPDSIGNLSRLDYIDLSNNQLSGKIPASLFQLHNLIQINLSCNSIVGALPADIAGLRQIDQI

DVSSNFLNGSIPESLGQLNMLTYLILSHNSLEGSIPSTLQSLTSLTWLDLSSNNLSGSIPMFLENLTDLTMLNLS

FNRLEGPIPEGGIFSNNLTRQSLIGNAGLCGSPRLGFSPCLKKSHPYSRPLLKLLLPAILVASGILAVFLYLMFE

KKHKKAKAYGDMADVIGPQLLTYHDLVLATENFSDDNLLGSGGFGKVFKGQLGSGLVVAIKVLDMKLEHSIRIFD

AECHILRMVRHRNLIKILNTCSNMDFKALVLEFMPNGSLEKLLHCSEGTMHLGFLERLNIMLDVSMAVHYLHHEH

YEVVLHCDLKPSNVLFDNDMTAHVADFGIAKLLLGDDNSMIVASMSGTVGYMAPEYGSMGKASRKSDVFSYGIML

LEVFTGRRPMDAMFLGDLISLREWVHQVFPTKLVHVVDRHLLQGSSSSSCNLDESFLVPIFELGLICSSDLPNER

MTMSDVVVRLKKIKVAYTEWISAT

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	108	131	1.8
LRR [Pfam ls]	132	155	0.04
LRR [Pfam ls]	156	180	0.0046
LRR [Pfam ls]	181	205	0.039
LRR [Pfam ls]	206	229	0.14
LRR [Pfam ls]	230	253	0.019
LRR [Pfam ls]	305	328	2.8
LRR [Pfam ls]	329	352	0.046
LRR [Pfam ls]	353	376	0.45
LRR [Pfam ls]	427	450	0.63
LRR [Pfam ls]	476	499	0.37
LRR [Pfam ls]	524	547	0.066
LRR [Pfam ls]	548	571	0.02
LRR [Pfam ls]	572	595	0.36
LRR [Pfam ls]	620	643	0.021
LRR [Pfam ls]	644	667	0.0064
Ser/Thr pkinase [Pfam fs]	783	984	2.7e-47
Ser/Thr pkinase [Pfam ls]	783	1033	6.2e-39

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	84	107	5.3
LRR [sensitive, ls]	84	107	58
LRR [sensitive, ls]	108	131	0.16
LRR [sensitive, ls]	108	131	1.8
LRR [sensitive, ls]	132	155	0.0036
LRR [sensitive, ls]	132	155	0.04
LRR [sensitive, ls]	156	180	0.00042
LRR [sensitive, ls]	156	180	0.0046
LRR [sensitive, ls]	181	205	0.0036
LRR [sensitive, ls]	181	205	0.039
LRR [sensitive, ls]	206	229	0.013
LRR [sensitive, ls]	206	229	0.14
LRR [sensitive, ls]	230	253	0.0017
LRR [sensitive, ls]	230	253	0.019
LRR [sensitive, ls]	281	304	2.5
LRR [sensitive, ls]	281	304	27
LRR [sensitive, ls]	305	328	0.25
LRR [sensitive, ls]	305	328	2.8
LRR [sensitive, ls]	329	352	0.0042
LRR [sensitive, ls]	329	352	0.046
LRR [sensitive, ls]	353	376	0.041
LRR [sensitive, ls]	353	376	0.45
LRR [sensitive, ls]	377	400	0.58
LRR [sensitive, ls]	377	400	6.3
LRR [sensitive, ls]	401	423	1.4
LRR [sensitive, ls]	401	423	15
LRR [sensitive, ls]	427	450	0.057
LRR [sensitive, ls]	427	450	0.63
LRR [sensitive, ls]	452	475	4.2
LRR [sensitive, ls]	452	475	46
LRR [sensitive, ls]	476	499	0.033
LRR [sensitive, ls]	476	499	0.37
LRR [sensitive, ls]	500	523	2.4
LRR [sensitive, ls]	500	523	27
LRR [sensitive, ls]	524	547	0.0061
LRR [sensitive, ls]	524	547	0.066
LRR [sensitive, ls]	548	571	0.0018
LRR [sensitive, ls]	548	571	0.02
LRR [sensitive, ls]	572	595	0.033
LRR [sensitive, ls]	572	595	0.36
LRR [sensitive, ls]	596	619	0.59
LRR [sensitive, ls]	596	619	6.5
LRR [sensitive, ls]	620	643	0.0019
LRR [sensitive, ls]	620	643	0.021
LRR [sensitive, ls]	644	667	0.00058
LRR [sensitive, ls]	644	667	0.0064
LRR [sensitive, ls]	668	692	0.59
LRR [sensitive, ls]	668	692	6.5

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	9	869	1e-125
FLS2 [A.thaliana]	33	685	9e-88
CLV2 [A. thaliana]	40	705	2e-60
Cf-9 [L. pimpinellifolium]	59	685	5e-58
Cf-9 [L. pimpinellifolium]	81	369	3e-17
Cf-9 [L. pimpinellifolium]	85	708	8e-64
FLS2 [A.thaliana]	88	1064	1e-133
CLV2 [A. thaliana]	154	708	7e-50
Cf-9 [L. pimpinellifolium]	160	687	1e-47
Cf-9 [L. pimpinellifolium]	266	713	3e-38
FLS2 [A.thaliana]	333	686	2e-54
FLS2 [A.thaliana]	417	691	1e-38
FLS2 [A.thaliana]	433	701	4e-32
FLS2 [A.thaliana]	440	701	4e-33
Pto [L. esculentum]	748	1061	7e-32
Rpg1 [Hordeum vulgare]	762	1065	9e-25
Rpg1 [Hordeum vulgare]	780	1065	3e-19

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	730	749	out -> in

Report for 4924.m00114

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)